Basic Information
ID: ALA2438448
Type: Binding
Description: Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to substrate addition measured after 3 hrs by spectrophotometry
Organism: Homo sapiens
Activity Charts
Bioactivity
Activity Types for Assay ALA2438448
IC50
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 405.95 | 3.58 | 3.58 |
| 367.95 | 4.20 | 4.20 |
| 423.63 | 5.14 | 5.14 |
| 413.59 | 4.46 | 4.46 |
| 408.52 | 3.22 | 3.22 |
| 397.97 | 3.96 | 3.96 |
| 431.52 | 4.33 | 4.33 |
| 377.90 | 2.85 | 2.85 |
| 425.94 | 4.08 | 4.08 |
| 395.92 | 4.32 | 4.32 |