Basic Information
ID: ALA3388952
Type: Binding
Description: Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasma
Organism: Homo sapiens
Tissue: Plasma
Activity Charts
Bioactivity
Activity Types for Assay ALA3388952
IC50
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 472.92 | 2.47 | 2.47 |
| 311.73 | 0.43 | 0.43 |
| 321.72 | 1.41 | 1.41 |
| 383.79 | 2.55 | 2.55 |
| 398.81 | 2.25 | 2.25 |
| 390.81 | 2.01 | 2.01 |
| 387.78 | 1.28 | 1.28 |
| 387.78 | 1.28 | 1.28 |
| 421.34 | 1.65 | 1.65 |