ID: ALA3388952
Type: Binding
Description: Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasma
Format: BAO_0000357
Organism: Homo sapiens
Tissue: Plasma
Target: ADAMTS5(ALA2285)
Document: ALA3351955
Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasma: 1
Bioactivity
Activity Types for Assay ALA3388952
IC50
Parent Molecular Weight | ALogP | Polar Surface Area |
---|---|---|
472.92 | 2.47 | 2.47 |
311.73 | 0.43 | 0.43 |
321.72 | 1.41 | 1.41 |
383.79 | 2.55 | 2.55 |
398.81 | 2.25 | 2.25 |
390.81 | 2.01 | 2.01 |
387.78 | 1.28 | 1.28 |
387.78 | 1.28 | 1.28 |
421.34 | 1.65 | 1.65 |