Basic Information
ID: ALA3999021
Type: Binding
Description: Inhibition of full-length recombinant human N-terminal GST-tagged CDK9/cyclin K expressed in baculovirus infected sf9 cells assessed as residual activity at 100 uM using [protein fragment, 39 aa] as substrate by ADP-Glo bioluminescence assay relative to control relative to control
Organism: Homo sapiens
Activity Charts
Bioactivity
Activity Types for Assay ALA3999021
Activity
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 430.56 | 5.87 | 5.87 |