Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillati...

Basic Information

ID: ALA4003785

Type: Binding

Description: Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method

Format: BAO_0000357

Organism: Homo sapiens

Target:  Tyrosine-protein kinase JAK2(ALA2971)

Document:  ALA4002601

Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method: 1

Activity Charts

Compound Summary

Parent Molecular WeightALogPPolar Surface Area
399.934.494.49
414.954.074.07
399.934.494.49