ID: ALA4003785
Type: Binding
Description: Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method
Format: BAO_0000357
Organism: Homo sapiens
Target: Tyrosine-protein kinase JAK2(ALA2971)
Document: ALA4002601
Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method: 1
Bioactivity
Activity Types for Assay ALA4003785
Inhibition
Parent Molecular Weight | ALogP | Polar Surface Area |
---|---|---|
399.93 | 4.49 | 4.49 |
414.95 | 4.07 | 4.07 |
399.93 | 4.49 | 4.49 |