ID: ALA4013266
Type: Binding
Description: Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasma by Alphascreen assay
Organism: Homo sapiens
Bioactivity
Activity Types for Assay ALA4013266
IC50
Parent Molecular Weight | ALogP | Polar Surface Area |
---|---|---|
472.92 | 2.47 | 2.47 |
411.42 | 2.62 | 2.62 |
397.40 | 2.38 | 2.38 |
409.41 | 2.38 | 2.38 |
383.37 | 1.99 | 1.99 |
397.40 | 2.38 | 2.38 |
383.37 | 1.99 | 1.99 |
369.34 | 1.74 | 1.74 |