Basic Information
ID: ALA4013266
Type: Binding
Description: Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasma by Alphascreen assay
Format: BAO_0000357
Organism: Homo sapiens
Target: ADAMTS5(ALA2285)
Document: ALA4011634
Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasma by Alphascreen assay: 1
Activity Charts
Bioactivity
Activity Types for Assay ALA4013266
IC50
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 472.92 | 2.47 | 2.47 |
| 411.42 | 2.62 | 2.62 |
| 397.40 | 2.38 | 2.38 |
| 409.41 | 2.38 | 2.38 |
| 383.37 | 1.99 | 1.99 |
| 397.40 | 2.38 | 2.38 |
| 383.37 | 1.99 | 1.99 |
| 369.34 | 1.74 | 1.74 |