Basic Information
ID: ALA4133277
Type: Binding
Description: Inhibition of recombinant human full length CDK9/Cyclin-T1 assessed as residual activity at 10 uM using [protein fragment, 39 aa] as substrate after 40 mins in presence of [gamma33P]-ATP by radiometric method relative to control
Organism: Homo sapiens
Activity Charts
Bioactivity
Activity Types for Assay ALA4133277
Activity
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 388.47 | 5.44 | 5.44 |
| 451.58 | 5.36 | 5.36 |
| 404.47 | 4.51 | 4.51 |
| 418.54 | 4.41 | 4.41 |
| 371.47 | 3.74 | 3.74 |
| 386.48 | 4.46 | 4.46 |
| 472.64 | 3.67 | 3.67 |
| 357.44 | 3.71 | 3.71 |
| 302.34 | 4.07 | 4.07 |
| 360.42 | 4.40 | 4.40 |
| 388.47 | 5.27 | 5.27 |
| 374.49 | 4.39 | 4.39 |
| 445.61 | 4.71 | 4.71 |
| 459.55 | 4.19 | 4.19 |
| 431.59 | 4.32 | 4.32 |
| 440.45 | 5.10 | 5.10 |
| 414.51 | 5.97 | 5.97 |
| 400.50 | 4.85 | 4.85 |
| 402.48 | 3.69 | 3.69 |
| 346.39 | 4.39 | 4.39 |
| 374.44 | 4.88 | 4.88 |
| 473.62 | 4.09 | 4.09 |
| 374.44 | 4.42 | 4.42 |