Basic Information
ID: ALA4258465
Type: ADME
Description: Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method
Organism: Homo sapiens
Activity Charts
Bioactivity
Activity Types for Assay ALA4258465
IC50
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 425.51 | 1.98 | 1.98 |
| 514.50 | 5.29 | 5.29 |
| 343.43 | 2.65 | 2.65 |
| 428.47 | 2.16 | 2.16 |
| 392.49 | 0.44 | 0.44 |
| 431.33 | 4.40 | 4.40 |
| 401.47 | 2.39 | 2.39 |
| 390.51 | 1.59 | 1.59 |
| 428.47 | 2.16 | 2.16 |
| 333.44 | 3.06 | 3.06 |
| 310.36 | 1.30 | 1.30 |
| 348.41 | 2.09 | 2.09 |
| 368.49 | 2.90 | 2.90 |
| 313.41 | 2.04 | 2.04 |
| 431.33 | 4.40 | 4.40 |
| 401.47 | 2.39 | 2.39 |
| 415.42 | 3.72 | 3.72 |
| 408.49 | 2.12 | 2.12 |
| 271.37 | 1.88 | 1.88 |
| 342.40 | 0.52 | 0.52 |
| 383.48 | 2.25 | 2.25 |
| 413.50 | 2.26 | 2.26 |
| 335.43 | 1.21 | 1.21 |
| 326.43 | 2.10 | 2.10 |
| 397.50 | 2.56 | 2.56 |
| 327.43 | 2.43 | 2.43 |
| 410.91 | 4.05 | 4.05 |
| 348.41 | 2.09 | 2.09 |
| 349.46 | 1.60 | 1.60 |
| 431.33 | 4.40 | 4.40 |
| 408.49 | 2.12 | 2.12 |
| 396.50 | 1.64 | 1.64 |
| 433.54 | 3.40 | 3.40 |
| 438.54 | 4.76 | 4.76 |
| 342.45 | 2.37 | 2.37 |
| 299.42 | 2.66 | 2.66 |
| 311.39 | 1.80 | 1.80 |
| 401.47 | 2.39 | 2.39 |
| 428.47 | 2.16 | 2.16 |
| 347.42 | 2.70 | 2.70 |
| 362.44 | 3.09 | 3.09 |
| 431.33 | 4.40 | 4.40 |
| 342.40 | 0.52 | 0.52 |
| 349.46 | 1.60 | 1.60 |
| 415.42 | 3.72 | 3.72 |
| 372.43 | 2.57 | 2.57 |
| 326.36 | 1.70 | 1.70 |
| 372.43 | 2.57 | 2.57 |
| 380.43 | 3.23 | 3.23 |
| 408.49 | 2.12 | 2.12 |
| 451.47 | 3.27 | 3.27 |
| 337.38 | 2.29 | 2.29 |