Basic Information
ID: ALA4377493
Type: Binding
Description: Inhibition of recombinant full-length human CDK9/cyclinT1 at 1 uM using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control
Format: BAO_0000223
Organism: Homo sapiens
Target: CDK9/cyclin T1(ALA2111389)
Document: ALA4376814
Inhibition of recombinant full-length human CDK9/cyclinT1 at 1 uM using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control: 1
Activity Charts
Bioactivity
Activity Types for Assay ALA4377493
Inhibition
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 434.55 | 2.80 | 2.80 |
| 547.73 | 5.77 | 5.77 |
| 478.63 | 5.46 | 5.46 |
| 565.72 | 5.91 | 5.91 |
| 492.61 | 3.61 | 3.61 |
| 551.69 | 5.52 | 5.52 |
| 617.82 | 5.48 | 5.48 |
| 506.64 | 4.00 | 4.00 |
| 615.73 | 7.39 | 7.39 |
| 505.65 | 5.20 | 5.20 |
| 527.68 | 3.76 | 3.76 |
| 509.61 | 4.35 | 4.35 |
| 521.65 | 4.31 | 4.31 |
| 507.62 | 3.92 | 3.92 |
| 548.72 | 5.17 | 5.17 |
| 491.62 | 4.21 | 4.21 |
| 520.66 | 4.39 | 4.39 |
| 565.72 | 6.51 | 6.51 |
| 537.67 | 5.13 | 5.13 |
| 505.65 | 4.60 | 4.60 |
| 471.63 | 4.13 | 4.13 |
| 491.62 | 4.81 | 4.81 |
| 561.76 | 6.05 | 6.05 |
| 583.78 | 5.32 | 5.32 |
| 533.70 | 5.38 | 5.38 |
| 563.73 | 5.48 | 5.48 |
| 533.70 | 5.98 | 5.98 |
| 519.68 | 4.99 | 4.99 |
| 565.72 | 6.51 | 6.51 |
| 547.73 | 6.37 | 6.37 |
| 549.70 | 5.09 | 5.09 |
| 534.69 | 4.78 | 4.78 |
| 547.73 | 6.37 | 6.37 |
| 535.67 | 4.70 | 4.70 |
| 555.73 | 4.54 | 4.54 |
| 547.73 | 6.37 | 6.37 |
| 569.76 | 4.93 | 4.93 |
| 541.70 | 4.15 | 4.15 |
| 406.51 | 4.73 | 4.73 |
| 519.68 | 5.59 | 5.59 |
| 523.64 | 4.74 | 4.74 |