ID: ALA4377493
Type: Binding
Description: Inhibition of recombinant full-length human CDK9/cyclinT1 at 1 uM using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control
Format: BAO_0000223
Organism: Homo sapiens
Target: CDK9/cyclin T1(ALA2111389)
Document: ALA4376814
Inhibition of recombinant full-length human CDK9/cyclinT1 at 1 uM using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control: 1
Bioactivity
Activity Types for Assay ALA4377493
Inhibition
Parent Molecular Weight | ALogP | Polar Surface Area |
---|---|---|
434.55 | 2.80 | 2.80 |
547.73 | 5.77 | 5.77 |
478.63 | 5.46 | 5.46 |
565.72 | 5.91 | 5.91 |
492.61 | 3.61 | 3.61 |
551.69 | 5.52 | 5.52 |
617.82 | 5.48 | 5.48 |
506.64 | 4.00 | 4.00 |
615.73 | 7.39 | 7.39 |
505.65 | 5.20 | 5.20 |
527.68 | 3.76 | 3.76 |
509.61 | 4.35 | 4.35 |
521.65 | 4.31 | 4.31 |
507.62 | 3.92 | 3.92 |
548.72 | 5.17 | 5.17 |
491.62 | 4.21 | 4.21 |
520.66 | 4.39 | 4.39 |
565.72 | 6.51 | 6.51 |
537.67 | 5.13 | 5.13 |
505.65 | 4.60 | 4.60 |
471.63 | 4.13 | 4.13 |
491.62 | 4.81 | 4.81 |
561.76 | 6.05 | 6.05 |
583.78 | 5.32 | 5.32 |
533.70 | 5.38 | 5.38 |
563.73 | 5.48 | 5.48 |
533.70 | 5.98 | 5.98 |
519.68 | 4.99 | 4.99 |
565.72 | 6.51 | 6.51 |
547.73 | 6.37 | 6.37 |
549.70 | 5.09 | 5.09 |
534.69 | 4.78 | 4.78 |
547.73 | 6.37 | 6.37 |
535.67 | 4.70 | 4.70 |
555.73 | 4.54 | 4.54 |
547.73 | 6.37 | 6.37 |
569.76 | 4.93 | 4.93 |
541.70 | 4.15 | 4.15 |
406.51 | 4.73 | 4.73 |
519.68 | 5.59 | 5.59 |
523.64 | 4.74 | 4.74 |