Basic Information
ID: ALA4377494
Type: Binding
Description: Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method
Format: BAO_0000223
Organism: Homo sapiens
Target: CDK9/cyclin T1(ALA2111389)
Document: ALA4376814
Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method: 1
Activity Charts
Bioactivity
Activity Types for Assay ALA4377494
IC50
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 434.55 | 2.80 | 2.80 |
| 547.73 | 5.77 | 5.77 |
| 565.72 | 5.91 | 5.91 |
| 551.69 | 5.52 | 5.52 |
| 509.61 | 4.35 | 4.35 |
| 521.65 | 4.31 | 4.31 |
| 507.62 | 3.92 | 3.92 |
| 537.67 | 5.13 | 5.13 |
| 583.78 | 5.32 | 5.32 |
| 565.72 | 6.51 | 6.51 |
| 547.73 | 6.37 | 6.37 |
| 535.67 | 4.70 | 4.70 |
| 547.73 | 6.37 | 6.37 |
| 569.76 | 4.93 | 4.93 |
| 523.64 | 4.74 | 4.74 |