Basic Information
ID: ALA4425629
Type: Binding
Description: Inhibition of rat ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay
Format: BAO_0000357
Organism: Rattus norvegicus
Target: A disintegrin and metalloproteinase with thrombospondin motifs 4(ALA4523453)
Document: ALA4425099
Inhibition of rat ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay: 1
Activity Charts
Bioactivity
Activity Types for Assay ALA4425629
Inhibition
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 390.81 | 2.01 | 2.01 |
| 387.78 | 1.28 | 1.28 |
| 421.34 | 1.65 | 1.65 |
| 381.31 | 2.17 | 2.17 |
| 435.36 | 1.96 | 1.96 |
| 435.36 | 2.13 | 2.13 |
| 401.81 | 1.59 | 1.59 |
| 401.81 | 1.77 | 1.77 |