Basic Information
ID: ALA4714985
Type: Binding
Description: Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20 min
Format: BAO_0000357
Organism: Homo sapiens
Target: Activin receptor type-2A(ALA5616)
Document: ALA4706744
Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20 min: 1
Activity Charts
Bioactivity
Activity Types for Assay ALA4714985
IC50
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 283.34 | 2.40 | 2.40 |
| 281.32 | 2.48 | 2.48 |
| 362.39 | 2.74 | 2.74 |
| 295.35 | 2.72 | 2.72 |
| 254.29 | 2.45 | 2.45 |
| 378.44 | 3.38 | 3.38 |
| 443.49 | 2.55 | 2.55 |
| 298.35 | 2.93 | 2.93 |
| 336.36 | 2.21 | 2.21 |
| 354.41 | 3.09 | 3.09 |
| 256.26 | 1.81 | 1.81 |
| 434.50 | 3.27 | 3.27 |
| 285.31 | 1.85 | 1.85 |
| 364.41 | 2.99 | 2.99 |
| 284.32 | 2.37 | 2.37 |
| 337.34 | 2.77 | 2.77 |
| 448.53 | 3.66 | 3.66 |
| 314.35 | 2.04 | 2.04 |
| 299.33 | 1.87 | 1.87 |
| 326.36 | 2.31 | 2.31 |
| 269.31 | 2.15 | 2.15 |
| 324.38 | 3.47 | 3.47 |
| 296.33 | 2.22 | 2.22 |
| 376.42 | 3.13 | 3.13 |
| 420.47 | 2.88 | 2.88 |
| 354.41 | 3.09 | 3.09 |
| 310.40 | 3.10 | 3.10 |
| 255.28 | 1.84 | 1.84 |
| 270.29 | 2.12 | 2.12 |