Basic Information
ID: ALA4830394
Type: Binding
Description: Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assay
Format: BAO_0000223
Organism: Homo sapiens
Target: CDK9/cyclin T1(ALA2111389)
Document: ALA4828743
Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assay: 1
Activity Charts
Bioactivity
Activity Types for Assay ALA4830394
IC50
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 396.50 | 2.28 | 2.28 |
| 508.48 | 4.32 | 4.32 |
| 510.55 | 4.23 | 4.23 |
| 496.53 | 3.92 | 3.92 |
| 524.58 | 4.48 | 4.48 |
| 493.62 | 4.64 | 4.64 |
| 523.59 | 5.57 | 5.57 |
| 538.61 | 5.04 | 5.04 |
| 481.51 | 4.51 | 4.51 |
| 482.50 | 3.68 | 3.68 |
| 525.57 | 4.36 | 4.36 |
| 507.65 | 4.98 | 4.98 |
| 495.54 | 4.52 | 4.52 |
| 467.58 | 4.47 | 4.47 |
| 481.51 | 4.31 | 4.31 |
| 492.63 | 5.20 | 5.20 |
| 486.48 | 3.76 | 3.76 |
| 491.60 | 4.39 | 4.39 |
| 480.58 | 4.68 | 4.68 |
| 482.50 | 4.78 | 4.78 |
| 538.61 | 4.87 | 4.87 |
| 481.51 | 4.51 | 4.51 |
| 552.64 | 5.26 | 5.26 |
| 450.55 | 5.43 | 5.43 |
| 482.59 | 5.29 | 5.29 |
| 507.60 | 4.12 | 4.12 |
| 499.55 | 4.64 | 4.64 |
| 482.50 | 3.70 | 3.70 |
| 507.65 | 5.35 | 5.35 |
| 483.48 | 4.17 | 4.17 |
| 507.65 | 4.98 | 4.98 |
| 411.55 | 4.16 | 4.16 |
| 468.57 | 4.90 | 4.90 |
| 496.53 | 3.92 | 3.92 |
| 481.61 | 4.81 | 4.81 |
| 481.51 | 4.51 | 4.51 |
| 482.50 | 3.70 | 3.70 |
| 479.59 | 4.25 | 4.25 |