ID: ALA5154505
Type: Binding
Description: Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method
Organism: Homo sapiens
Bioactivity
Activity Types for Assay ALA5154505
IC50
Parent Molecular Weight | ALogP | Polar Surface Area |
---|---|---|
425.51 | 1.98 | 1.98 |
351.41 | 2.10 | 2.10 |
403.43 | 2.88 | 2.88 |
429.47 | 3.22 | 3.22 |
418.50 | 2.87 | 2.87 |
403.43 | 2.88 | 2.88 |
401.42 | 2.79 | 2.79 |
406.49 | 2.87 | 2.87 |
435.45 | 3.52 | 3.52 |
401.42 | 2.79 | 2.79 |
429.47 | 3.22 | 3.22 |
365.44 | 2.54 | 2.54 |
401.42 | 2.79 | 2.79 |
385.44 | 2.72 | 2.72 |
403.43 | 2.88 | 2.88 |
443.50 | 3.61 | 3.61 |
373.36 | 1.96 | 1.96 |
443.50 | 3.61 | 3.61 |
457.53 | 4.00 | 4.00 |
355.37 | 1.81 | 1.81 |
420.52 | 3.11 | 3.11 |
443.50 | 3.61 | 3.61 |
463.50 | 4.30 | 4.30 |
401.42 | 2.79 | 2.79 |
401.42 | 2.79 | 2.79 |
449.48 | 3.91 | 3.91 |
364.45 | 2.56 | 2.56 |
403.43 | 2.88 | 2.88 |
415.44 | 2.83 | 2.83 |
420.52 | 3.26 | 3.26 |
392.46 | 2.48 | 2.48 |
429.47 | 3.22 | 3.22 |
403.43 | 2.88 | 2.88 |
417.46 | 3.22 | 3.22 |
415.44 | 2.83 | 2.83 |
411.48 | 3.07 | 3.07 |
443.50 | 3.61 | 3.61 |
378.48 | 2.95 | 2.95 |