Basic Information
ID: ALA5154505
Type: Binding
Description: Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method
Organism: Homo sapiens
Activity Charts
Bioactivity
Activity Types for Assay ALA5154505
IC50
Compound Summary
| Parent Molecular Weight | ALogP | Polar Surface Area |
|---|---|---|
| 425.51 | 1.98 | 1.98 |
| 351.41 | 2.10 | 2.10 |
| 403.43 | 2.88 | 2.88 |
| 429.47 | 3.22 | 3.22 |
| 418.50 | 2.87 | 2.87 |
| 403.43 | 2.88 | 2.88 |
| 401.42 | 2.79 | 2.79 |
| 406.49 | 2.87 | 2.87 |
| 435.45 | 3.52 | 3.52 |
| 401.42 | 2.79 | 2.79 |
| 429.47 | 3.22 | 3.22 |
| 365.44 | 2.54 | 2.54 |
| 401.42 | 2.79 | 2.79 |
| 385.44 | 2.72 | 2.72 |
| 403.43 | 2.88 | 2.88 |
| 443.50 | 3.61 | 3.61 |
| 373.36 | 1.96 | 1.96 |
| 443.50 | 3.61 | 3.61 |
| 457.53 | 4.00 | 4.00 |
| 355.37 | 1.81 | 1.81 |
| 420.52 | 3.11 | 3.11 |
| 443.50 | 3.61 | 3.61 |
| 463.50 | 4.30 | 4.30 |
| 401.42 | 2.79 | 2.79 |
| 401.42 | 2.79 | 2.79 |
| 449.48 | 3.91 | 3.91 |
| 364.45 | 2.56 | 2.56 |
| 403.43 | 2.88 | 2.88 |
| 415.44 | 2.83 | 2.83 |
| 420.52 | 3.26 | 3.26 |
| 392.46 | 2.48 | 2.48 |
| 429.47 | 3.22 | 3.22 |
| 403.43 | 2.88 | 2.88 |
| 417.46 | 3.22 | 3.22 |
| 415.44 | 2.83 | 2.83 |
| 411.48 | 3.07 | 3.07 |
| 443.50 | 3.61 | 3.61 |
| 378.48 | 2.95 | 2.95 |