#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA2320996	B	Stabilization of CDK2/Cyclin A (174 to 432 amino acid residues) (unknown origin) assessed as change in melting temperature at 20 uM by differential scanning fluorimetry assay	Homo sapiens	13		protein complex format	Scientific Literature
2.	ALA2320997	B	Stabilization of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) assessed as change in melting temperature at 20 uM by differential scanning fluorimetry assay	Homo sapiens	18		protein complex format	Scientific Literature
3.	ALA2320998	B	Inhibition of CDK2/Cyclin A (174 to 432 amino acid residues) (unknown origin) by differential scanning fluorimetry assay	Homo sapiens	18		protein complex format	Scientific Literature
4.	ALA2320999	B	Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assay	Homo sapiens	18		protein complex format	Scientific Literature
5.	ALA4820723	B	Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintillation counting method	Homo sapiens	30		protein complex format	Scientific Literature
6.	ALA4820725	B	Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintillation counting method	Homo sapiens	31		protein complex format	Scientific Literature
7.	ALA4820726	B	Selectivity index, ratio of Ki for inhibition of recombinant human full length CDK2/Cyclin A to Ki for inhibition of recombinant human full length CDK9/Cyclin T1	Homo sapiens	30		assay format	Scientific Literature
8.	ALA4820727	F	Growth inhibition of human HCT-116 cells after 48 hrs by MTT assay	Homo sapiens	30		cell-based format	Scientific Literature
9.	ALA4820728	F	Growth inhibition of human MCF7 cells after 48 hrs by MTT assay	Homo sapiens	30		cell-based format	Scientific Literature