#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA3388950	B	Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay	Homo sapiens	9		single protein format	Scientific Literature
2.	ALA3388951	B	Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay	Homo sapiens	9		single protein format	Scientific Literature
3.	ALA3388952	B	Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasma	Homo sapiens	9		single protein format	Scientific Literature
4.	ALA3388953	B	Inhibition of human MMP2 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9		single protein format	Scientific Literature
5.	ALA3388954	B	Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9		single protein format	Scientific Literature
6.	ALA3388955	B	Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9		single protein format	Scientific Literature
7.	ALA3388956	B	Inhibition of human MMP14 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9		single protein format	Scientific Literature
8.	ALA3388957	B	Inhibition of human TACE using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9		single protein format	Scientific Literature
9.	ALA3388958	A	Plasma concentration in rat at 10 mg/kg, po after 2 hrs	Rattus norvegicus	9		organism-based format	Scientific Literature
10.	ALA3388959	A	Plasma concentration in rat at 10 mg/kg, po after 8 hrs	Rattus norvegicus	9		organism-based format	Scientific Literature