| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA3388950 | B | Inhibition of human ADAMTS-4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assay | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 2. | ALA3388951 | B | Inhibition of human ADAMTS-5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assay | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 3. | ALA3388952 | B | Inhibition of human ADAMTS-5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assay in presence of 50% rat plasma | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 4. | ALA3388953 | B | Inhibition of human MMP2 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 5. | ALA3388954 | B | Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 6. | ALA3388955 | B | Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 7. | ALA3388956 | B | Inhibition of human MMP14 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 8. | ALA3388957 | B | Inhibition of human TACE using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 9. | ALA3388958 | A | Plasma concentration in rat at 10 mg/kg, po after 2 hrs | Rattus norvegicus | 9 | organism-based format | Scientific Literature | ||
| 10. | ALA3388959 | A | Plasma concentration in rat at 10 mg/kg, po after 8 hrs | Rattus norvegicus | 9 | organism-based format | Scientific Literature | ||
| 11. | ALA3388961 | F | Reduction in meniscal tear-induced osteoarthritis total joint score in chronic BID Lewis rat surgical model | Rattus norvegicus | 2 | organism-based format | Scientific Literature | ||
| 12. | ALA3388962 | A | AUC in Sprague-Dawley rat at 10 mg/kg, po | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
| 13. | ALA3388963 | A | Cmax in Sprague-Dawley rat at 10 mg/kg, po | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
| 14. | ALA3388964 | A | Tmax in Sprague-Dawley rat at 10 mg/kg, po | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
| 15. | ALA3388965 | A | Half life in Sprague-Dawley rat at 10 mg/kg, po | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
| 16. | ALA3388966 | A | Clearance in Sprague-Dawley rat | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
| 17. | ALA3388967 | A | Oral bioavailability in Sprague-Dawley rat | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
| 18. | ALA3388968 | A | Inhibition of human CYP2D6 | Homo sapiens | 3 | single protein format | Scientific Literature | ||
| 19. | ALA3389532 | A | Inhibition of human CYP2C9 | Homo sapiens | 3 | single protein format | Scientific Literature | ||
| 20. | ALA3389533 | A | Inhibition of human CYP3A4 | Homo sapiens | 3 | single protein format | Scientific Literature |
The page will load shortly, Thanks for your patience!