#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA3388950	Binding	Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay	Homo sapiens	9	ALA3351955	single protein format	Scientific Literature
2.	ALA3388951	Binding	Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay	Homo sapiens	9	ALA3351955	single protein format	Scientific Literature
3.	ALA3388952	Binding	Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasma	Homo sapiens	9	ALA3351955	single protein format	Scientific Literature
4.	ALA3388953	Binding	Inhibition of human MMP2 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9	ALA3351955	single protein format	Scientific Literature
5.	ALA3388954	Binding	Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9	ALA3351955	single protein format	Scientific Literature
6.	ALA3388955	Binding	Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9	ALA3351955	single protein format	Scientific Literature
7.	ALA3388956	Binding	Inhibition of human MMP14 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9	ALA3351955	single protein format	Scientific Literature
8.	ALA3388957	Binding	Inhibition of human TACE using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs	Homo sapiens	9	ALA3351955	single protein format	Scientific Literature
9.	ALA3388958	ADME	Plasma concentration in rat at 10 mg/kg, po after 2 hrs	Rattus norvegicus	9	ALA3351955	organism-based format	Scientific Literature
10.	ALA3388959	ADME	Plasma concentration in rat at 10 mg/kg, po after 8 hrs	Rattus norvegicus	9	ALA3351955	organism-based format	Scientific Literature
11.	ALA3388960	Functional	Reduction in ADAMTS-4/ADAMTS-5-mediated aggrecan cleavage products in po dosed Lewis rat MIA model assessed as aggrecanase-cleaved fragments treatment starting from day 3 and single dose given on day 7 followed by animal sacrificed 4 hrs later by NITEGE sandwich ELISA assay	Rattus norvegicus	2	ALA3351955	organism-based format	Scientific Literature
12.	ALA3388961	Functional	Reduction in meniscal tear-induced osteoarthritis total joint score in chronic BID Lewis rat surgical model	Rattus norvegicus	2	ALA3351955	organism-based format	Scientific Literature
13.	ALA3388962	ADME	AUC in Sprague-Dawley rat at 10 mg/kg, po	Rattus norvegicus	3	ALA3351955	organism-based format	Scientific Literature
14.	ALA3388963	ADME	Cmax in Sprague-Dawley rat at 10 mg/kg, po	Rattus norvegicus	3	ALA3351955	organism-based format	Scientific Literature
15.	ALA3388964	ADME	Tmax in Sprague-Dawley rat at 10 mg/kg, po	Rattus norvegicus	3	ALA3351955	organism-based format	Scientific Literature
16.	ALA3388965	ADME	Half life in Sprague-Dawley rat at 10 mg/kg, po	Rattus norvegicus	3	ALA3351955	organism-based format	Scientific Literature
17.	ALA3388966	ADME	Clearance in Sprague-Dawley rat	Rattus norvegicus	3	ALA3351955	organism-based format	Scientific Literature
18.	ALA3388967	ADME	Oral bioavailability in Sprague-Dawley rat	Rattus norvegicus	3	ALA3351955	organism-based format	Scientific Literature
19.	ALA3388968	ADME	Inhibition of human CYP2D6	Homo sapiens	3	ALA3351955	single protein format	Scientific Literature
20.	ALA3389532	ADME	Inhibition of human CYP2C9	Homo sapiens	3	ALA3351955	single protein format	Scientific Literature