# | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
---|---|---|---|---|---|---|---|---|---|
1. | ALA3388950 | B | Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay | Homo sapiens | 9 | single protein format | Scientific Literature | ||
2. | ALA3388951 | B | Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay | Homo sapiens | 9 | single protein format | Scientific Literature | ||
3. | ALA3388952 | B | Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasma | Homo sapiens | 9 | single protein format | Scientific Literature | ||
4. | ALA3388953 | B | Inhibition of human MMP2 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
5. | ALA3388954 | B | Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
6. | ALA3388955 | B | Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
7. | ALA3388956 | B | Inhibition of human MMP14 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
8. | ALA3388957 | B | Inhibition of human TACE using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs | Homo sapiens | 9 | single protein format | Scientific Literature | ||
9. | ALA3388958 | A | Plasma concentration in rat at 10 mg/kg, po after 2 hrs | Rattus norvegicus | 9 | organism-based format | Scientific Literature | ||
10. | ALA3388959 | A | Plasma concentration in rat at 10 mg/kg, po after 8 hrs | Rattus norvegicus | 9 | organism-based format | Scientific Literature | ||
11. | ALA3388960 | F | Reduction in ADAMTS-4/ADAMTS-5-mediated aggrecan cleavage products in po dosed Lewis rat MIA model assessed as aggrecanase-cleaved fragments treatment starting from day 3 and single dose given on day 7 followed by animal sacrificed 4 hrs later by NITEGE sandwich ELISA assay | Rattus norvegicus | 2 | organism-based format | Scientific Literature | ||
12. | ALA3388961 | F | Reduction in meniscal tear-induced osteoarthritis total joint score in chronic BID Lewis rat surgical model | Rattus norvegicus | 2 | organism-based format | Scientific Literature | ||
13. | ALA3388962 | A | AUC in Sprague-Dawley rat at 10 mg/kg, po | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
14. | ALA3388963 | A | Cmax in Sprague-Dawley rat at 10 mg/kg, po | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
15. | ALA3388964 | A | Tmax in Sprague-Dawley rat at 10 mg/kg, po | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
16. | ALA3388965 | A | Half life in Sprague-Dawley rat at 10 mg/kg, po | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
17. | ALA3388966 | A | Clearance in Sprague-Dawley rat | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
18. | ALA3388967 | A | Oral bioavailability in Sprague-Dawley rat | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
19. | ALA3388968 | A | Inhibition of human CYP2D6 | Homo sapiens | 3 | single protein format | Scientific Literature | ||
20. | ALA3389532 | A | Inhibition of human CYP2C9 | Homo sapiens | 3 | single protein format | Scientific Literature |