| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA3776325 | B | Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated histone H3 (1 to 21 residues) lysine 9 trimethylated peptide/2 uM alpha-ketoglutarate as substrate/cofactor measured after 45 mins by TR-FRET assay | Homo sapiens | 36 | ALA3774347 | assay format | Scientific Literature | |
| 2. | ALA3776326 | B | Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated histone H3 (1 to 21 residues) lysine 9 trimethylated peptide/50 uM alpha-ketoglutarate as substrate/cofactor measured after 45 mins by TR-FRET assay | Homo sapiens | 15 | ALA3774347 | assay format | Scientific Literature | |
| 3. | ALA3776327 | B | Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 50 uM ARK(Me3)STGGK peptide/50 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis | Homo sapiens | 3 | ALA3774347 | assay format | Scientific Literature | |
| 4. | ALA3776328 | B | Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 250 uM ARK(Me3)STGGK peptide/50 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis | Homo sapiens | 3 | ALA3774347 | assay format | Scientific Literature | |
| 5. | ALA3776329 | B | Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 50 uM ARK(Me3)STGGK peptide/5 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis | Homo sapiens | 3 | ALA3774347 | assay format | Scientific Literature | |
| 6. | ALA3776330 | B | Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using ARTKQTARK(Me3)STGGKA peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 7. | ALA3776331 | B | Inhibition of N-terminal His6-tagged full-length FIH (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using SMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 8. | ALA3776332 | B | Inhibition of KDM5A (1 to 797 residues) (unknown origin) expressed in insect sf21 cells using ARTK(Me3)QTARKSTGGKAPRK peptide/ 100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay | Homo sapiens | 6 | ALA3774347 | cell-based format | Scientific Literature | |
| 9. | ALA3776333 | B | Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated peptide/ 2 uM alpha-ketoglutarate as substrate/cofactor preincubated for 15 mins followed by substrate addition measured after 15 mins by alphascreen assay | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 10. | ALA3776334 | B | Inhibition of KDM2A (unknown origin) expressed in Escherichia coli using Biotin H3 (28 to 48 residues) Me2 KDM2A Cognate Ligande/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 15 mins followed by substrate addition measured after 30 mins by alphascreen assay | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 11. | ALA3776335 | B | Inhibition of KDM6B (unknown origin) expressed in Escherichia coli using H3 (21 to 44 residues) K27Me3-GGK-Biotin JMJD3 Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 5 mins by alphascreen assay | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 12. | ALA3776336 | B | Inhibition of KDM5B (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K4Me3-GGK-Biotin KDM5B Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 13. | ALA3776337 | B | Inhibition of KDM3A (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K9Me2-GGK-Biotin KDM3A Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 14. | ALA3776338 | B | Inhibition of KDM4D (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K9Me3-GGK-Biotin KDM4 Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 15. | ALA3776339 | B | Selectivity ratio of IC50 for KDM5A (unknown origin) expressed in Escherichia coli to IC50 for KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 16. | ALA3776340 | B | Selectivity ratio of IC50 for FIH (unknown origin) expressed in Escherichia coli to IC50 for KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 17. | ALA3776341 | B | Selectivity ratio of IC50 for KDM2A (unknown origin) expressed in Escherichia coli to IC50 for KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 18. | ALA3776342 | B | Selectivity ratio of IC50 for KDM6B (unknown origin) expressed in Escherichia coli to IC50 for KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 19. | ALA3776343 | B | Selectivity ratio of IC50 for KDM5B (unknown origin) expressed in Escherichia coli to IC50 for KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature | |
| 20. | ALA3776344 | B | Selectivity ratio of IC50 for KDM3A (unknown origin) expressed in Escherichia coli to IC50 for KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli | Homo sapiens | 6 | ALA3774347 | assay format | Scientific Literature |
The page will load shortly, Thanks for your patience!