| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4059185 | B | Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 39 | ALA4052828 | protein complex format | Scientific Literature | |
| 2. | ALA4059187 | B | Inhibition of human FLT3 using EAIYAAPFAKKK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 39 | ALA4052828 | single protein format | Scientific Literature | |
| 3. | ALA4059189 | F | Growth inhibition of human MV4-11 cells after 72 hrs by CellTiter-Glo assay | Homo sapiens | 39 | ALA4052828 | cell-based format | Scientific Literature | |
| 4. | ALA4059194 | B | Inhibition of human CDK4/Cyclin D1 using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 5 | ALA4052828 | protein complex format | Scientific Literature | |
| 5. | ALA4059195 | B | Inhibition of human CDK6/Cyclin D1 using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 5 | ALA4052828 | protein complex format | Scientific Literature | |
| 6. | ALA4059196 | B | Inhibition of human CDK9/Cyclin K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 1 | ALA4052828 | protein complex format | Scientific Literature | |
| 7. | ALA4059197 | B | Inhibition of human FLT1 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 1 | ALA4052828 | single protein format | Scientific Literature | |
| 8. | ALA4059198 | B | Inhibition of human KDR using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 1 | ALA4052828 | single protein format | Scientific Literature | |
| 9. | ALA4059199 | B | Inhibition of human ALK using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 1 | ALA4052828 | single protein format | Scientific Literature | |
| 10. | ALA4059200 | B | Inhibition of human CDK1/Cyclin E using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 1 | ALA4052828 | protein complex format | Scientific Literature | |
| 11. | ALA4059201 | F | Growth inhibition of human RS4:11 cells after 72 hrs by CellTiter-Glo assay | Homo sapiens | 4 | ALA4052828 | cell-based format | Scientific Literature | |
| 12. | ALA4059202 | F | Growth inhibition of human MCF7 cells after 72 hrs by CellTiter-Glo assay | Homo sapiens | 4 | ALA4052828 | cell-based format | Scientific Literature | |
| 13. | ALA4059203 | F | Growth inhibition of human HCT116 cells after 72 hrs by CellTiter-Glo assay | Homo sapiens | 4 | ALA4052828 | cell-based format | Scientific Literature | |
| 14. | ALA4059204 | F | Growth inhibition of human NCI-H82 cells after 72 hrs by CellTiter-Glo assay | Homo sapiens | 4 | ALA4052828 | cell-based format | Scientific Literature | |
| 15. | ALA4059245 | F | Growth inhibition of human MGC803 cells after 72 hrs by CellTiter-Glo assay | Homo sapiens | 4 | ALA4052828 | cell-based format | Scientific Literature | |
| 16. | ALA4155881 | A | Inhibition of CDK2 (unknown origin) by Hotspot assay | Homo sapiens | 4 | ALA4152300 | single protein format | Scientific Literature | |
| 17. | ALA4155882 | B | Inhibition of CDK6 (unknown origin) by Hotspot assay | Homo sapiens | 4 | ALA4152300 | single protein format | Scientific Literature | |
| 18. | ALA4155885 | B | Inhibition of human FLT3 by Hotspot assay | Homo sapiens | 18 | ALA4152300 | single protein format | Scientific Literature | |
| 19. | ALA4155886 | A | Inhibition of CDK2 (unknown origin) at 0.123 uM by Hotspot assay relative to control | Homo sapiens | 4 | ALA4152300 | single protein format | Scientific Literature | |
| 20. | ALA4155887 | B | Inhibition of CDK6 (unknown origin) at 0.123 uM by Hotspot assay relative to control | Homo sapiens | 4 | ALA4152300 | single protein format | Scientific Literature |
The page will load shortly, Thanks for your patience!