#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA4059185	B	Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	39		protein complex format	Scientific Literature
2.	ALA4059187	B	Inhibition of human FLT3 using EAIYAAPFAKKK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	39		single protein format	Scientific Literature
3.	ALA4059189	F	Growth inhibition of human MV4-11 cells after 72 hrs by CellTiter-Glo assay	Homo sapiens	39		cell-based format	Scientific Literature
4.	ALA4059194	B	Inhibition of human CDK4/Cyclin D1 using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	5		protein complex format	Scientific Literature
5.	ALA4059195	B	Inhibition of human CDK6/Cyclin D1 using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	5		protein complex format	Scientific Literature
6.	ALA4059196	B	Inhibition of human CDK9/Cyclin K using [protein fragment, 39 aa] as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	1		protein complex format	Scientific Literature
7.	ALA4059197	B	Inhibition of human FLT1 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	1		single protein format	Scientific Literature
8.	ALA4059198	B	Inhibition of human KDR using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	1		single protein format	Scientific Literature
9.	ALA4059199	B	Inhibition of human ALK using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	1		single protein format	Scientific Literature
10.	ALA4059200	B	Inhibition of human CDK1/Cyclin E using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method	Homo sapiens	1		protein complex format	Scientific Literature
11.	ALA4059201	F	Growth inhibition of human RS4:11 cells after 72 hrs by CellTiter-Glo assay	Homo sapiens	4		cell-based format	Scientific Literature
12.	ALA4059202	F	Growth inhibition of human MCF7 cells after 72 hrs by CellTiter-Glo assay	Homo sapiens	4		cell-based format	Scientific Literature
13.	ALA4059203	F	Growth inhibition of human HCT116 cells after 72 hrs by CellTiter-Glo assay	Homo sapiens	4		cell-based format	Scientific Literature
14.	ALA4059204	F	Growth inhibition of human NCI-H82 cells after 72 hrs by CellTiter-Glo assay	Homo sapiens	4		cell-based format	Scientific Literature
15.	ALA4059245	F	Growth inhibition of human MGC803 cells after 72 hrs by CellTiter-Glo assay	Homo sapiens	4		cell-based format	Scientific Literature
16.	ALA4155881	A	Inhibition of CDK2 (unknown origin) by Hotspot assay	Homo sapiens	4		single protein format	Scientific Literature
17.	ALA4155882	B	Inhibition of CDK6 (unknown origin) by Hotspot assay	Homo sapiens	4		single protein format	Scientific Literature
18.	ALA4155885	B	Inhibition of human FLT3 by Hotspot assay	Homo sapiens	18		single protein format	Scientific Literature
19.	ALA4155886	A	Inhibition of CDK2 (unknown origin) at 0.123 uM by Hotspot assay relative to control	Homo sapiens	4		single protein format	Scientific Literature
20.	ALA4155887	B	Inhibition of CDK6 (unknown origin) at 0.123 uM by Hotspot assay relative to control	Homo sapiens	4		single protein format	Scientific Literature