| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4003763 | Binding | Inhibition of human BRAF using myelin basic protein as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 2. | ALA4003764 | Binding | Inhibition of human DYRK1A using RRRFRPASPLRGPPK as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 3. | ALA4003765 | Binding | Inhibition of CLK mediated SF3B1 activation in human SK-MEL-2 cells assessed as MDM2-pre mRNA exon skipping after 4 hrs by luciferase reporter gene assay relative to control | Homo sapiens | 22 | ALA4002601 | cell-based format | Scientific Literature | |
| 4. | ALA4003768 | Binding | Inhibition of human CLK1 using substrate ERMRPRKRQGSVRRRV in presence of [gamma-33P]ATP after 40 mins by scintillation counter method | Homo sapiens | 19 | ALA4002601 | single protein format | Scientific Literature | |
| 5. | ALA4003769 | Binding | Inhibition of human CLK2 using YRRAAVPPSPSLSRHSSPHQS(p)EDEEE as substrate in presence of [gamma-33P]ATP after 40 mins by scintillation counter method | Homo sapiens | 17 | ALA4002601 | single protein format | Scientific Literature | |
| 6. | ALA4003770 | Binding | Inhibition of human CLK3 using ERMRPRKRQGSVRRRV as substrate in presence of [gamma-33P]ATP after 40 mins by scintillation counter method | Homo sapiens | 17 | ALA4002601 | single protein format | Scientific Literature | |
| 7. | ALA4003771 | Binding | Inhibition of human CLK4 using YRRAAVPPSPSLSRHSSPHQS(p)EDEEE as substrate in presence of [gamma-33P]ATP after 40 mins by scintillation counter method | Homo sapiens | 17 | ALA4002601 | single protein format | Scientific Literature | |
| 8. | ALA4003772 | Binding | Inhibition of human CDK1/cyclinB using Histone H1 as substrate in presence of [gamma-33P]ATP after 40 mins by scintillation counter method | Homo sapiens | 17 | ALA4002601 | protein complex format | Scientific Literature | |
| 9. | ALA4003773 | Binding | Inhibition of human CDK4/cyclinD3 using Histone H1 as substrate in presence of [gamma-33P]ATP after 40 mins by scintillation counter method | Homo sapiens | 17 | ALA4002601 | protein complex format | Scientific Literature | |
| 10. | ALA4003774 | Binding | Inhibition of human CDK6/cyclinD3 using Histone H1 as substrate in presence of [gamma-33P]ATP after 40 mins by scintillation counter method | Homo sapiens | 17 | ALA4002601 | protein complex format | Scientific Literature | |
| 11. | ALA4003776 | Binding | Inhibition of human Abl using EAIYAAPFAKK as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 12. | ALA4003777 | Binding | Inhibition of human ALK using casein as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 13. | ALA4003778 | Binding | Inhibition of human Aurora-A using Kemptide as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 14. | ALA4003779 | Binding | Inhibition of human Aurora-B using AKRRRLSSLRA as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 15. | ALA4003780 | Binding | Inhibition of human EGFR using poly(Glu, Tyr) 4:1 as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 16. | ALA4003781 | Binding | Inhibition of human ErbB2 using poly(Glu, Tyr) as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 17. | ALA4003782 | Binding | Inhibition of human Flt3 using EAIYAAPFAKKK as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 18. | ALA4003783 | Binding | Inhibition of human Fms using KKKSPGEYVNIEFG as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 19. | ALA4003784 | Binding | Inhibition of human IKKbeta using KKKKERLLDDRHDSGLDSMKDEE as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature | |
| 20. | ALA4003785 | Binding | Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate in presence of [gamma-33P]ATP at 1 uM after 40 mins by scintillation counter method | Homo sapiens | 3 | ALA4002601 | single protein format | Scientific Literature |
The page will load shortly, Thanks for your patience!