| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4013269 | B | Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay | Homo sapiens | 10 | single protein format | Scientific Literature | ||
| 2. | ALA4425556 | B | Inhibition of human ADAMTS4 using 43-mer VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate measured after 3 hrs by AlphaScreen assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 3. | ALA4425557 | B | Inhibition of human ADAMTS5 using 43-mer VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate measured after 3 hrs by AlphaScreen assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 4. | ALA4425558 | B | Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hrs by AlphaScreen assay | Homo sapiens | 8 | cell-free format | Scientific Literature | ||
| 5. | ALA4425559 | B | Inhibition of human MMP1 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 6. | ALA4425560 | B | Inhibition of human MMP2 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 7. | ALA4425561 | B | Inhibition of human MMP3 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 8. | ALA4425562 | B | Inhibition of human MMP7 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 9. | ALA4425563 | B | Inhibition of human MMP9 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 10. | ALA4425564 | B | Inhibition of human MMP13 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 11. | ALA4425565 | B | Inhibition of human MMP14 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 12. | ALA4425566 | B | Inhibition of human TACE using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 13. | ALA4425571 | A | Ratio of plasma concentration in Lewis rat at 10 mg/kg, po bid measured after 8 hrs to IC50 for human ADAMTS5 in presence of rat plasma | 8 | organism-based format | Scientific Literature | |||
| 14. | ALA4425594 | A | Fraction unbound in rat plasma | Rattus norvegicus | 2 | cell-free format | Scientific Literature | ||
| 15. | ALA4425597 | A | Plasma concentration in Lewis rat model of MIA at 1.8 mg/mL, po administered through infusion pump post 3 days MIA induction | Rattus norvegicus | 1 | organism-based format | Scientific Literature | ||
| 16. | ALA4425598 | A | Plasma concentration in Lewis rat model of MIA at 6 mg/mL, po administered through infusion pump post 3 days MIA induction | Rattus norvegicus | 1 | organism-based format | Scientific Literature | ||
| 17. | ALA4425599 | A | Plasma concentration in Lewis rat model of MIA at 18 mg/mL, po administered through infusion pump post 3 days MIA induction | Rattus norvegicus | 1 | organism-based format | Scientific Literature | ||
| 18. | ALA4425600 | A | Plasma concentration in Lewis rat model of MIA at 60 mg/mL, po administered through infusion pump post 3 days MIA induction | Rattus norvegicus | 1 | organism-based format | Scientific Literature | ||
| 19. | ALA4425601 | A | Ratio of plasma concentration in Lewis rat model of MIA at 1.8 mg/mL, po administered through infusion pump post 3 days MIA induction to IC50 for human ADAMTS5 in presence of rat plasma | 1 | organism-based format | Scientific Literature | |||
| 20. | ALA4425602 | A | Ratio of plasma concentration in Lewis rat model of MIA at 6 mg/mL, po administered through infusion pump post 3 days MIA induction to IC50 for human ADAMTS5 in presence of rat plasma | 1 | organism-based format | Scientific Literature |
The page will load shortly, Thanks for your patience!