#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA4013264	Binding	Inhibition of human ADAMTS4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assay	Homo sapiens	8	ALA4011634	single protein format	Scientific Literature
2.	ALA4013265	Binding	Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assay	Homo sapiens	8	ALA4011634	single protein format	Scientific Literature
3.	ALA4013266	Binding	Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasma by Alphascreen assay	Homo sapiens	8	ALA4011634	single protein format	Scientific Literature
4.	ALA4013267	Binding	Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay	Homo sapiens	8	ALA4011634	single protein format	Scientific Literature
5.	ALA4013268	Binding	Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay	Homo sapiens	8	ALA4011634	single protein format	Scientific Literature
6.	ALA4013269	Binding	Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay	Homo sapiens	10	ALA4011634	single protein format	Scientific Literature
7.	ALA4013270	Binding	Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay	Homo sapiens	8	ALA4011634	single protein format	Scientific Literature
8.	ALA4013271	Binding	Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay	Homo sapiens	8	ALA4011634	single protein format	Scientific Literature
9.	ALA4013285	ADME	Drug metabolism in po or iv dosed bile-duct cannulated rat assessed as glutathione conjugation by HPLC-MS analysis	Rattus norvegicus	8	ALA4011634	organism-based format	Scientific Literature