| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4013264 | B | Inhibition of human ADAMTS4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 2. | ALA4013265 | B | Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 3. | ALA4013266 | B | Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasma by Alphascreen assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 4. | ALA4013267 | B | Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 5. | ALA4013268 | B | Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 6. | ALA4013269 | B | Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay | Homo sapiens | 10 | single protein format | Scientific Literature | ||
| 7. | ALA4013270 | B | Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 8. | ALA4013271 | B | Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 9. | ALA4013285 | A | Drug metabolism in po or iv dosed bile-duct cannulated rat assessed as glutathione conjugation by HPLC-MS analysis | Rattus norvegicus | 8 | organism-based format | Scientific Literature |
The page will load shortly, Thanks for your patience!