#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA4133270	F	Growth inhibition of human MV4-11 cells after 72 hrs by resazurin dye based assay	Homo sapiens	32		cell-based format	Scientific Literature
2.	ALA4133271	B	Inhibition of recombinant full length human N-terminal GST-tagged MNK1 expressed in insect cells assessed as residual activity at 10 uM using N-terminal TAMRA-labeled eIF4E (202 to 214 residues) as substrate by IMAP TR-FRET assay relative to control	Homo sapiens	32		cell-based format	Scientific Literature
3.	ALA4133272	B	Inhibition of recombinant full length human N-terminal GST-tagged MNK2 expressed in baculovirus expression system assessed as residual activity at 10 uM using N-terminal TAMRA-labeled eIF4E (202 to 214 residues) as substrate by IMAP TR-FRET assay relative to control	Homo sapiens	32		assay format	Scientific Literature
4.	ALA4133273	B	Inhibition of recombinant human FLT3 using EAIYAAPFAKKK as substrate by ATP-Glo assay	Homo sapiens	11		single protein format	Scientific Literature
5.	ALA4133274	B	Inhibition of recombinant full length human N-terminal GST-tagged MNK1 expressed in insect cells using N-terminal TAMRA-labeled eIF4E (202 to 214 residues) as substrate by IMAP TR-FRET assay	Homo sapiens	10		cell-based format	Scientific Literature
6.	ALA4133275	B	Inhibition of recombinant full length human N-terminal GST-tagged MNK2 expressed in baculovirus expression system using N-terminal TAMRA-labeled eIF4E (202 to 214 residues) as substrate by IMAP TR-FRET assay	Homo sapiens	23		assay format	Scientific Literature
7.	ALA4133276	B	Inhibition of recombinant human full length CDK2/Cyclin-A assessed as residual activity at 10 uM using histone H1 as substrate after 40 mins in presence of [gamma33P]-ATP by radiometric method relative to control	Homo sapiens	23		protein complex format	Scientific Literature
8.	ALA4133277	B	Inhibition of recombinant human full length CDK9/Cyclin-T1 assessed as residual activity at 10 uM using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate after 40 mins in presence of [gamma33P]-ATP by radiometric method relative to control	Homo sapiens	23		protein complex format	Scientific Literature
9.	ALA4133279	B	ATP competitive inhibition of recombinant full length human N-terminal GST-tagged MNK2 expressed in baculovirus expression system assessed as ratio of IC50 in presence of 2 mM ATP to IC50 in presence of 0.05 mM ATP using eIF4E (202 to 214 residues) as substrate by ADP-Glo assay	Homo sapiens	4		assay format	Scientific Literature
10.	ALA4133281	B	Competitive inhibition of recombinant full length human N-terminal GST-tagged MNK2 expressed in baculovirus expression system assessed as ratio of IC50 in presence of 3 mM eIF4E substrate to IC50 in presence of 0.15 mM eIF4E substrate by ADP-Glo assay	Homo sapiens	4		assay format	Scientific Literature
11.	ALA4133284	B	Inhibition of recombinant human FLT3 assessed as residual activity at 10 uM using EAIYAAPFAKKK as substrate by ATP-Glo assay relative to control	Homo sapiens	2		single protein format	Scientific Literature
12.	ALA4133285	B	Inhibition of FLT1 (unknown origin) at 10 uM relative to control	Homo sapiens	2		single protein format	Scientific Literature
13.	ALA4133286	B	Inhibition of CDK1/Cyclin-B (unknown origin) assessed as residual activity at 10 uM relative to control	Homo sapiens	2		protein complex format	Scientific Literature
14.	ALA4133287	B	Inhibition of CDK4/Cyclin-D1 (unknown origin) assessed as residual activity at 10 uM relative to control	Homo sapiens	2		protein complex format	Scientific Literature
15.	ALA4133288	B	Inhibition of CDK6/Cyclin-D3 (unknown origin) assessed as residual activity at 10 uM relative to control	Homo sapiens	2		protein complex format	Scientific Literature
16.	ALA4133289	B	Inhibition of CDK7/Cyclin-H (unknown origin) assessed as residual activity at 10 uM relative to control	Homo sapiens	2		protein complex format	Scientific Literature
17.	ALA4133290	B	Inhibition of BRAF (unknown origin) assessed as residual activity at 10 uM relative to control	Homo sapiens	2		single protein format	Scientific Literature
18.	ALA4133291	B	Inhibition of MAPK1 (unknown origin) assessed as residual activity at 10 uM relative to control	Homo sapiens	2		single protein format	Scientific Literature
19.	ALA4133292	B	Inhibition of MAPK2 (unknown origin) assessed as residual activity at 10 uM relative to control	Homo sapiens	2		single protein format	Scientific Literature
20.	ALA4133293	B	Inhibition of PI3K (unknown origin) assessed as residual activity at 10 uM relative to control	Homo sapiens	2		assay format	Scientific Literature