| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4258464 | B | Inhibition of human JAK1 using GEEPLYWSFPAKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method | Homo sapiens | 54 | ALA4257478 | single protein format | Scientific Literature | |
| 2. | ALA4258465 | A | Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method | Homo sapiens | 52 | ALA4257478 | single protein format | Scientific Literature | |
| 3. | ALA4258466 | B | Selectivity index, ratio of IC50 for human JAK2 to IC50 for human JAK1 | Homo sapiens | 51 | ALA4257478 | assay format | Scientific Literature | |
| 4. | ALA4258467 | B | Inhibition of human JAK3 using GGEEEEYFELVKKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method | Homo sapiens | 3 | ALA4257478 | single protein format | Scientific Literature | |
| 5. | ALA4258468 | B | Inhibition of human TYK2 using GGMEDIYFEFMGGKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method | Homo sapiens | 3 | ALA4257478 | single protein format | Scientific Literature | |
| 6. | ALA4258469 | B | Selectivity index, ratio of IC50 for human JAK3 to IC50 for human JAK1 | Homo sapiens | 1 | ALA4257478 | assay format | Scientific Literature | |
| 7. | ALA4258470 | B | Selectivity index, ratio of IC50 for human TYK2 to IC50 for human JAK1 | Homo sapiens | 1 | ALA4257478 | assay format | Scientific Literature | |
| 8. | ALA4258471 | A | Metabolic stability in human plasma assessed as parent compound remaining at 10 uM after 30 mins by LC-MS/MS method | Homo sapiens | 3 | ALA4257478 | cell-free format | Scientific Literature | |
| 9. | ALA4258472 | A | Metabolic stability in human plasma assessed as parent compound remaining at 10 uM after 120 mins by LC-MS/MS method | Homo sapiens | 3 | ALA4257478 | cell-free format | Scientific Literature | |
| 10. | ALA4258473 | A | Metabolic stability in rat plasma assessed as parent compound remaining at 10 uM after 30 mins by LC-MS/MS method | Rattus norvegicus | 3 | ALA4257478 | cell-free format | Scientific Literature | |
| 11. | ALA4258474 | A | Metabolic stability in rat plasma assessed as parent compound remaining at 10 uM after 120 mins by LC-MS/MS method | Rattus norvegicus | 3 | ALA4257478 | cell-free format | Scientific Literature | |
| 12. | ALA4258475 | A | Protein binding in human plasma at 10 uM after 4 hrs by rapid equilibrium dialysis method | Homo sapiens | 3 | ALA4257478 | cell-free format | Scientific Literature | |
| 13. | ALA4258476 | A | Protein binding in rat plasma at 10 uM after 4 hrs by rapid equilibrium dialysis method | Rattus norvegicus | 3 | ALA4257478 | cell-free format | Scientific Literature | |
| 14. | ALA4258477 | P | Lipophilicity, log P of the compound in neutral form | 3 | ALA4257478 | small-molecule physicochemical format | Scientific Literature | ||
| 15. | ALA4258478 | A | Metabolic stability in human liver microsomes assessed as parent compound remaining at 1 uM preincubated for 5 mins followed by addition of NADPH regenerating system and measured after 30 mins by LC-MS/MS method | Homo sapiens | 3 | ALA4257478 | microsome format | Scientific Literature | |
| 16. | ALA4258479 | A | Metabolic stability in dog liver microsomes assessed as parent compound remaining at 1 uM preincubated for 5 mins followed by addition of NADPH regenerating system and measured after 30 mins by LC-MS/MS method | Canis lupus familiaris | 3 | ALA4257478 | microsome format | Scientific Literature | |
| 17. | ALA4258480 | A | Metabolic stability in rat liver microsomes assessed as parent compound remaining at 1 uM preincubated for 5 mins followed by addition of NADPH regenerating system and measured after 30 mins by LC-MS/MS method | Rattus norvegicus | 3 | ALA4257478 | microsome format | Scientific Literature | |
| 18. | ALA4258481 | A | Metabolic stability in mouse liver microsomes assessed as parent compound remaining at 1 uM preincubated for 5 mins followed by addition of NADPH regenerating system and measured after 30 mins by LC-MS/MS method | Mus musculus | 3 | ALA4257478 | microsome format | Scientific Literature | |
| 19. | ALA4258482 | A | Apparent permeability across apical to basolateral side in human Caco2 cells at 25 uM measured every 15 mins for 60 mins by LC-MS/MS method | Homo sapiens | 3 | ALA4257478 | cell-based format | Scientific Literature | |
| 20. | ALA4258483 | A | Apparent permeability across basolateral to apical side in human Caco2 cells at 25 uM measured every 15 mins for 60 mins by LC-MS/MS method | Homo sapiens | 3 | ALA4257478 | cell-based format | Scientific Literature |
The page will load shortly, Thanks for your patience!