| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4425556 | B | Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 2. | ALA4425557 | B | Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 3. | ALA4425558 | B | Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hrs by AlphaScreen assay | Homo sapiens | 8 | cell-free format | Scientific Literature | ||
| 4. | ALA4425559 | B | Inhibition of human MMP1 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 5. | ALA4425560 | B | Inhibition of human MMP2 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 6. | ALA4425561 | B | Inhibition of human MMP3 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 7. | ALA4425562 | B | Inhibition of human MMP7 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 8. | ALA4425563 | B | Inhibition of human MMP9 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 9. | ALA4425564 | B | Inhibition of human MMP13 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 10. | ALA4425565 | B | Inhibition of human MMP14 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 11. | ALA4425566 | B | Inhibition of human TACE using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence analysis | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 12. | ALA4425567 | A | AUC in Lewis rat at 10 mg/kg, po | Rattus norvegicus | 7 | organism-based format | Scientific Literature | ||
| 13. | ALA4425568 | A | Cmax in Lewis rat plasma at 10 mg/kg, po | Rattus norvegicus | 7 | organism-based format | Scientific Literature | ||
| 14. | ALA4425569 | A | Ratio of Cmax in Lewis rat plasma to IC50 for human ADAMTS5 in presence of Lewis rat plasma | 7 | assay format | Scientific Literature | |||
| 15. | ALA4425570 | A | Plasma concentration in Lewis rat at 10 mg/kg, po bid measured after 8 hrs | Rattus norvegicus | 7 | organism-based format | Scientific Literature | ||
| 16. | ALA4425571 | A | Ratio of plasma concentration in Lewis rat at 10 mg/kg, po bid measured after 8 hrs to IC50 for human ADAMTS5 in presence of rat plasma | 8 | organism-based format | Scientific Literature | |||
| 17. | ALA4425572 | F | Reduction in ADAMTS-4/ADAMTS-5 mediated aggrecan cleavage products in Lewis rat model of MIA assessed as aggrecanase-cleaved fragments at 10 mg/kg, po bid administered post 3 days MIA induction measured after 4 hrs of last dosage on day 7 by NITEGE sandwich ELISA | Rattus norvegicus | 4 | organism-based format | Scientific Literature | ||
| 18. | ALA4425573 | F | Reduction in ADAMTS-4/ADAMTS-5 mediated aggrecan cleavage products in Lewis rat model of MIA assessed as aggrecanase-cleaved fragments at 30 mg/kg, po bid administered post 3 days MIA induction measured after 4 hrs of last dosage on day 7 by NITEGE sandwich ELISA | Rattus norvegicus | 5 | organism-based format | Scientific Literature | ||
| 19. | ALA4425574 | F | Reduction in ADAMTS-4/ADAMTS-5 mediated aggrecan cleavage products in Lewis rat model of MIA assessed as aggrecanase-cleaved fragments at 100 mg/kg, po bid administered post 3 days MIA induction measured after 4 hrs of last dosage on day 7 by NITEGE sandwich ELISA | Rattus norvegicus | 3 | organism-based format | Scientific Literature | ||
| 20. | ALA4425575 | A | Plasma concentration in Lewis rat model of MIA at 10 mg/kg, po bid administered post 3 days MIA induction measured after 4 hrs of last dosage on day 7 | Rattus norvegicus | 4 | organism-based format | Scientific Literature |
The page will load shortly, Thanks for your patience!