#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA4377489	Binding	Inhibition of recombinant full-length human CDK4/cyclinD3 at 1 uM using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
2.	ALA4377490	Binding	Inhibition of recombinant full-length human CDK4/cyclinD3 using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method	Homo sapiens	2	ALA4376814	protein complex format	Scientific Literature
3.	ALA4377491	Binding	Inhibition of recombinant full-length human CDK6/cyclinD3 at 1 uM using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
4.	ALA4377492	Binding	Inhibition of recombinant full-length human CDK6/cyclinD3 using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method	Homo sapiens	2	ALA4376814	protein complex format	Scientific Literature
5.	ALA4377493	Binding	Inhibition of recombinant full-length human CDK9/cyclinT1 at 1 uM using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
6.	ALA4377494	Binding	Inhibition of recombinant full-length human CDK9/cyclinT1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method	Homo sapiens	15	ALA4376814	protein complex format	Scientific Literature
7.	ALA4377495	Binding	Inhibition of recombinant full-length human CDK4/cyclinD3 at 500 nM using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	31	ALA4376814	protein complex format	Scientific Literature
8.	ALA4377496	Binding	Inhibition of recombinant full-length human CDK6/cyclinD3 at 500 nM using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	30	ALA4376814	protein complex format	Scientific Literature
9.	ALA4377497	Binding	Inhibition of recombinant full-length human CDK9/cyclinT1 at 500 nM using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	38	ALA4376814	protein complex format	Scientific Literature
10.	ALA4377498	Functional	Antiproliferative activity against human A549 cells assessed as inhibition of cell viability at 1 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	27	ALA4376814	cell-based format	Scientific Literature
11.	ALA4377499	Functional	Antiproliferative activity against human A549 cells assessed as inhibition of cell viability at 10 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	27	ALA4376814	cell-based format	Scientific Literature
12.	ALA4377500	Functional	Antiproliferative activity against human H1299 cells assessed as inhibition of cell viability at 1 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	27	ALA4376814	cell-based format	Scientific Literature
13.	ALA4377501	Functional	Antiproliferative activity against human H1299 cells assessed as inhibition of cell viability at 10 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	27	ALA4376814	cell-based format	Scientific Literature
14.	ALA4377502	Functional	Antiproliferative activity against human MCF7 cells assessed as inhibition of cell viability at 10 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	2	ALA4376814	cell-based format	Scientific Literature
15.	ALA4377503	Functional	Antiproliferative activity against human MCF7 cells assessed as inhibition of cell viability at 500 nM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	2	ALA4376814	cell-based format	Scientific Literature
16.	ALA4377504	Functional	Antiproliferative activity against human HepG2 cells assessed as inhibition of cell viability at 10 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	2	ALA4376814	cell-based format	Scientific Literature
17.	ALA4377505	Functional	Antiproliferative activity against human HepG2 cells assessed as inhibition of cell viability at 500 nM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	2	ALA4376814	cell-based format	Scientific Literature
18.	ALA4377506	Functional	Antiproliferative activity against human SiHa cells assessed as inhibition of cell viability at 10 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	2	ALA4376814	cell-based format	Scientific Literature
19.	ALA4377507	Functional	Antiproliferative activity against human SiHa cells assessed as inhibition of cell viability at 500 nM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	2	ALA4376814	cell-based format	Scientific Literature
20.	ALA4377508	Functional	Antiproliferative activity against human A549 cells assessed as inhibition of cell viability after 72 hrs by CCK-8 assay	Homo sapiens	3	ALA4376814	cell-based format	Scientific Literature