#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA4377489	Binding	Inhibition of recombinant full-length human CDK4/cyclinD3 at 1 uM using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
2.	ALA4377491	Binding	Inhibition of recombinant full-length human CDK6/cyclinD3 at 1 uM using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
3.	ALA4377493	Binding	Inhibition of recombinant full-length human CDK9/cyclinT1 at 1 uM using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
4.	ALA4377497	Binding	Inhibition of recombinant full-length human CDK9/cyclinT1 at 500 nM using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	38	ALA4376814	protein complex format	Scientific Literature