#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA4377489	Binding	Inhibition of recombinant full-length human CDK4/cyclinD3 at 1 uM using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
2.	ALA4377491	Binding	Inhibition of recombinant full-length human CDK6/cyclinD3 at 1 uM using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
3.	ALA4377493	Binding	Inhibition of recombinant full-length human CDK9/cyclinT1 at 1 uM using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	41	ALA4376814	protein complex format	Scientific Literature
4.	ALA4377495	Binding	Inhibition of recombinant full-length human CDK4/cyclinD3 at 500 nM using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	31	ALA4376814	protein complex format	Scientific Literature
5.	ALA4377496	Binding	Inhibition of recombinant full-length human CDK6/cyclinD3 at 500 nM using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	30	ALA4376814	protein complex format	Scientific Literature
6.	ALA4377497	Binding	Inhibition of recombinant full-length human CDK9/cyclinT1 at 500 nM using [protein fragment, 39 aa] peptide as substrate measured after 40 mins in presence of [gamma33P]ATP by scintillation counting method relative to control	Homo sapiens	38	ALA4376814	protein complex format	Scientific Literature
7.	ALA4377498	Functional	Antiproliferative activity against human A549 cells assessed as inhibition of cell viability at 1 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	27	ALA4376814	cell-based format	Scientific Literature
8.	ALA4377499	Functional	Antiproliferative activity against human A549 cells assessed as inhibition of cell viability at 10 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	27	ALA4376814	cell-based format	Scientific Literature
9.	ALA4377500	Functional	Antiproliferative activity against human H1299 cells assessed as inhibition of cell viability at 1 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	27	ALA4376814	cell-based format	Scientific Literature
10.	ALA4377501	Functional	Antiproliferative activity against human H1299 cells assessed as inhibition of cell viability at 10 uM after 72 hrs by CCK-8 assay relative to control	Homo sapiens	27	ALA4376814	cell-based format	Scientific Literature