#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA4714984	Binding	Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measured after 50 min	Homo sapiens	29	ALA4706744	single protein format	Scientific Literature
2.	ALA4714985	Binding	Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20 min	Homo sapiens	29	ALA4706744	single protein format	Scientific Literature
3.	ALA4714987	Functional	Inhibition of TGFbeta-1-induced Smad3 phosphorylation in human Epi293F cells pretreated for 10 mins followed by addition of TGF-beta1 measured after 120 mins by AlphaLISA assay	Homo sapiens	30	ALA4706744	cell-based format	Scientific Literature
4.	ALA4714988	Functional	Inhibition of Activin A-induced Smad3 phosphorylation in human Epi293F cells pretreated for 10 mins followed by addition of TGF-beta1 measured after 120 mins by AlphaLISA assay	Homo sapiens	28	ALA4706744	cell-based format	Scientific Literature
5.	ALA4714989	ADME	Metabolic stability in human liver microsomes assessed as compound remaining at 1 uM incubated for 60 mins	Homo sapiens	18	ALA4706744	microsome format	Scientific Literature
6.	ALA4714990	ADME	Metabolic stability in rat liver microsomes assessed as compound remaining at 1 uM incubated for 60 mins	Rattus norvegicus	18	ALA4706744	microsome format	Scientific Literature