| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4720431 | B | Inhibition of human COT1 assessed as residual activity using MEK1 as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 2. | ALA4720432 | B | Inhibition of human CLK3 assessed as residual activity using MBP as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 3. | ALA4720433 | B | Inhibition of human CLK1 assessed as residual activity using MBP as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 4. | ALA4720434 | B | Inhibition of human CLK2 assessed as residual activity using MBP as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 5. | ALA4720435 | B | Inhibition of human CK2A2 assessed as residual activity using RRRDDDSDDD as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 6. | ALA4720436 | B | Inhibition of human CK2A assessed as residual activity using RRRDDDSDDD as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 7. | ALA4720437 | B | Inhibition of human CK1gamma3 assessed as residual activity using KRRRAL[pS]VASLPGL as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 8. | ALA4720438 | B | Inhibition of human CK1gamma2 assessed as residual activity using KRRRAL[pS]VASLPGL as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 9. | ALA4720439 | B | Inhibition of human CK1gamma1 assessed as residual activity using KRRRAL[pS]VASLPGL as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 10. | ALA4720440 | B | Inhibition of human CK1E assessed as residual activity using KRRRAL[pS]VASLPGL as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 11. | ALA4720441 | B | Inhibition of human CK1a1L assessed as residual activity using KRRRAL[pS]VASLPGL as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 12. | ALA4720442 | B | Inhibition of human CK1D assessed as residual activity using KRRRAL[pS]VASLPGL as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 13. | ALA4720443 | B | Inhibition of human CHK2 assessed as residual activity using KKKVSRSGLYRSPSMPENLNRPR as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 14. | ALA4720444 | B | Inhibition of human CHK1 assessed as residual activity using KKKVSRSGLYRSPSMPENLNRPR as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | single protein format | Scientific Literature | |
| 15. | ALA4720445 | B | Inhibition of human CDK9/cyclin-K assessed as residual activity using [protein fragment, 39 aa] as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | protein complex format | Scientific Literature | |
| 16. | ALA4720446 | B | Inhibition of human CDK9/cyclin-T1 assessed as residual activity using [protein fragment, 39 aa] as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | protein complex format | Scientific Literature | |
| 17. | ALA4720447 | B | Inhibition of human CDK7/cyclin-H assessed as residual activity using MBP as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | protein complex format | Scientific Literature | |
| 18. | ALA4720448 | B | Inhibition of human CDK6/cyclin-D3 assessed as residual activity using RB protein as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | protein complex format | Scientific Literature | |
| 19. | ALA4720449 | B | Inhibition of human CDK6/cyclin-D1 assessed as residual activity using RB protein as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | protein complex format | Scientific Literature | |
| 20. | ALA4720450 | B | Inhibition of human CDK5/p35 assessed as residual activity using histone H1 as substrate at 1 uM by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4715818 | protein complex format | Scientific Literature |
The page will load shortly, Thanks for your patience!