| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4737441 | B | Inhibition of human N-terminal GST-tagged CDK2 (1 to 298 residues)/Cyclin A (174 to 432 residues) expressed in Escherichia coli Turner (DE3) cells assessed as reduction in ADP formation using PKTPKKAKKL as substrate by resorufin dye based fluorescence assay | Homo sapiens | 50 | cell-based format | Scientific Literature | ||
| 2. | ALA4737442 | B | Inhibition of CDK1/CyclinA (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 3. | ALA4737443 | B | Inhibition of CDK1/Cyclin B (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 4. | ALA4737444 | B | Inhibition of human N-terminal GST-tagged CDK2 (1 to 298 residues)/Cyclin A (174 to 432 residues) expressed in Escherichia coli Turner (DE3) cells assessed as reduction in ADP formation at 1 uM using PKTPKKAKKL as substrate by resorufin dye based fluorescence assay | Homo sapiens | 1 | cell-based format | Scientific Literature | ||
| 5. | ALA4737445 | B | Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 6. | ALA4737446 | B | Inhibition of CDK1/Cyclin E (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 7. | ALA4737447 | B | Inhibition of CDK1/Cyclin-O (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 8. | ALA4737448 | B | Inhibition of CDK3/Cyclin E (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 9. | ALA4737449 | B | Inhibition of CDK4/Cyclin D1 (unknown origin) at 1 uM using RB protein as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 10. | ALA4737450 | B | Inhibition of CDK5/p25 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 11. | ALA4737451 | B | Inhibition of CDK6/Cyclin D1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 12. | ALA4737452 | B | Inhibition of CDK7/Cyclin H (unknown origin) at 1 uM using myelin basic protein as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 13. | ALA4737453 | B | Inhibition of CDK9/Cyclin T1 (unknown origin) at 1 uM using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method | Homo sapiens | 1 | assay format | Scientific Literature |
The page will load shortly, Thanks for your patience!