# | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
---|---|---|---|---|---|---|---|---|---|
1. | ALA4714984 | Binding | Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measured after 50 min | Homo sapiens | 29 | ALA4706744 | single protein format | Scientific Literature | |
2. | ALA4714985 | Binding | Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20 min | Homo sapiens | 29 | ALA4706744 | single protein format | Scientific Literature | |
3. | ALA4714986 | Binding | Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 min | Homo sapiens | 8 | ALA4706744 | single protein format | Scientific Literature | |
4. | ALA4714987 | Functional | Inhibition of TGFbeta-1-induced Smad3 phosphorylation in human Epi293F cells pretreated for 10 mins followed by addition of TGF-beta1 measured after 120 mins by AlphaLISA assay | Homo sapiens | 30 | ALA4706744 | cell-based format | Scientific Literature |