#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA4830392	Binding	Inhibition of human CDK4/cyclin-D1 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
2.	ALA4830393	Binding	Inhibition of human CDK5/p25 using histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
3.	ALA4830394	Binding	Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	38	ALA4828743	protein complex format	Scientific Literature
4.	ALA4830395	Functional	Growth inhibition of human MV4-11 cells incubated after 72 hrs by CTG- luminescence assay	Homo sapiens	38	ALA4828743	cell-based format	Scientific Literature
5.	ALA4830396	Binding	Inhibition of human CDK1/cyclinB using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
6.	ALA4830397	Binding	Inhibition of human CDK2/cyclinA using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
7.	ALA4830398	Binding	Inhibition of human CDK3/cyclinE using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
8.	ALA4830399	Binding	Inhibition of human CDK6/cyclin-D3 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
9.	ALA4830400	Binding	Inhibition of human CDK7/cyclin-H using MBP as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
10.	ALA4830401	Binding	Inhibition of human CDK8/cyclin C incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
11.	ALA4830402	Binding	Inhibition of human CDK14/cyclin-Y using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
12.	ALA4830403	Binding	Inhibition of human CDK16/cyclin-Y using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assay	Homo sapiens	2	ALA4828743	protein complex format	Scientific Literature
13.	ALA4830404	Physicochemical	Kinetic solubility of the compound in PBS buffer at pH 7.4 by HPLC analysis		10	ALA4828743	small-molecule physicochemical format	Scientific Literature