#	Aladdin ID	Assay Type	Description	Organism	Compounds	Reference	BAO Format	Source
1.	ALA5046580	B	Inhibition of recombinant human DRAK1 using KKLNRTLSFAEPG as substrate after 40 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay	Homo sapiens	7	ALA5046221	single protein format	Scientific Literature
2.	ALA5046586	B	Displacement of tracer K9 from NLuc fused DRAK1 (unknown origin) expressed in HEK293 cells by NanoBRET assay	Homo sapiens	22	ALA5046221	cell-based format	Scientific Literature
3.	ALA5046587	B	Displacement of tracer K9 from NLuc fused MARK3 (unknown origin) expressed in HEK293 cells by NanoBRET assay	Homo sapiens	23	ALA5046221	cell-based format	Scientific Literature
4.	ALA5046588	B	Displacement of tracer K5 from NLuc fused MARK4 (unknown origin) expressed in HEK293 cells by NanoBRET assay	Homo sapiens	23	ALA5046221	cell-based format	Scientific Literature
5.	ALA5046589	B	Displacement of tracer K5 from NLuc fused TBK1 (unknown origin) expressed in HEK293 cells by NanoBRET assay	Homo sapiens	22	ALA5046221	cell-based format	Scientific Literature
6.	ALA5046592	B	Inhibition of recombinant human DRAK2 using KKRPQRRYSNVF as substrate after 120 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay	Homo sapiens	2	ALA5046221	single protein format	Scientific Literature
7.	ALA5046593	B	Inhibition of human AAK1 using peptide as substrate incubated for 120 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay	Homo sapiens	4	ALA5046221	single protein format	Scientific Literature
8.	ALA5046599	B	Inhibition of human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate measured after 40 mins in presence of [gamma33P]ATP by radiometric scintillation counting method	Homo sapiens	5	ALA5046221	single protein format	Scientific Literature
9.	ALA5046602	B	Inhibition of recombinant human JAK2 (808 to end residues) using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of [gamma-33P-ATP] by radiometric scintillation assay	Homo sapiens	1	ALA5046221	single protein format	Scientific Literature
10.	ALA5046603	B	Inhibition of recombinant human SIK2 (1 to 276 residues) using KKKVSRSGLYRSPSMPENLNRPR as substrate measured after 40 mins in presence of [gamma33P]ATP by radiometric scintillation counting method	Homo sapiens	2	ALA5046221	single protein format	Scientific Literature
11.	ALA5046607	B	Inhibition of full length recombinant human MKNK2 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma-33P-ATP] by radiometric scintillation assay	Homo sapiens	5	ALA5046221	single protein format	Scientific Literature
12.	ALA5046628	P	Kinetic solubility of compound in PBS at pH 7.4 incubated for 24 hrs by chemiluminscent nitrogen detection method		23	ALA5046221	small-molecule physicochemical format	Scientific Literature
13.	ALA5046629	A	Effective permeability in PBS at 7.4 incubated for 5 hrs by PAMPA analysis		23	ALA5046221	assay format	Scientific Literature
14.	ALA5046634	B	Inhibition of human BMP2K at 1 uM using peptide as substrate incubated for 120 mins in presence of [gamma-33P-ATP] by radiometric scintillation assay relative to control	Homo sapiens	2	ALA5046221	single protein format	Scientific Literature