| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA5046580 | B | Inhibition of recombinant human DRAK1 using KKLNRTLSFAEPG as substrate after 40 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay | Homo sapiens | 7 | single protein format | Scientific Literature | ||
| 2. | ALA5046586 | B | Displacement of tracer K9 from NLuc fused DRAK1 (unknown origin) expressed in HEK293 cells by NanoBRET assay | Homo sapiens | 22 | cell-based format | Scientific Literature | ||
| 3. | ALA5046587 | B | Displacement of tracer K9 from NLuc fused MARK3 (unknown origin) expressed in HEK293 cells by NanoBRET assay | Homo sapiens | 23 | cell-based format | Scientific Literature | ||
| 4. | ALA5046588 | B | Displacement of tracer K5 from NLuc fused MARK4 (unknown origin) expressed in HEK293 cells by NanoBRET assay | Homo sapiens | 23 | cell-based format | Scientific Literature | ||
| 5. | ALA5046589 | B | Displacement of tracer K5 from NLuc fused TBK1 (unknown origin) expressed in HEK293 cells by NanoBRET assay | Homo sapiens | 22 | cell-based format | Scientific Literature | ||
| 6. | ALA5046592 | B | Inhibition of recombinant human DRAK2 using KKRPQRRYSNVF as substrate after 120 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay | Homo sapiens | 2 | single protein format | Scientific Literature | ||
| 7. | ALA5046593 | B | Inhibition of human AAK1 using peptide as substrate incubated for 120 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay | Homo sapiens | 4 | single protein format | Scientific Literature | ||
| 8. | ALA5046599 | B | Inhibition of human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate measured after 40 mins in presence of [gamma33P]ATP by radiometric scintillation counting method | Homo sapiens | 5 | single protein format | Scientific Literature | ||
| 9. | ALA5046602 | B | Inhibition of recombinant human JAK2 (808 to end residues) using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of [gamma-33P-ATP] by radiometric scintillation assay | Homo sapiens | 1 | single protein format | Scientific Literature | ||
| 10. | ALA5046603 | B | Inhibition of recombinant human SIK2 (1 to 276 residues) using KKKVSRSGLYRSPSMPENLNRPR as substrate measured after 40 mins in presence of [gamma33P]ATP by radiometric scintillation counting method | Homo sapiens | 2 | single protein format | Scientific Literature | ||
| 11. | ALA5046607 | B | Inhibition of full length recombinant human MKNK2 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma-33P-ATP] by radiometric scintillation assay | Homo sapiens | 5 | single protein format | Scientific Literature | ||
| 12. | ALA5046628 | P | Kinetic solubility of compound in PBS at pH 7.4 incubated for 24 hrs by chemiluminscent nitrogen detection method | 23 | small-molecule physicochemical format | Scientific Literature | |||
| 13. | ALA5046629 | A | Effective permeability in PBS at 7.4 incubated for 5 hrs by PAMPA analysis | 23 | assay format | Scientific Literature | |||
| 14. | ALA5046634 | B | Inhibition of human BMP2K at 1 uM using peptide as substrate incubated for 120 mins in presence of [gamma-33P-ATP] by radiometric scintillation assay relative to control | Homo sapiens | 2 | single protein format | Scientific Literature |
The page will load shortly, Thanks for your patience!