# | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
---|---|---|---|---|---|---|---|---|---|
1. | ALA5154504 | B | Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method | Homo sapiens | 38 | single protein format | Scientific Literature | ||
2. | ALA5154505 | B | Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method | Homo sapiens | 38 | single protein format | Scientific Literature | ||
3. | ALA5154506 | B | Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method | Homo sapiens | 38 | single protein format | Scientific Literature | ||
4. | ALA5154507 | B | Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method | Homo sapiens | 38 | single protein format | Scientific Literature | ||
5. | ALA5154508 | B | Selectivity index, ratio of IC50 for inhibition of recombinant human JAK2 to IC50 for inhibition of recombinant human JAK1 | Homo sapiens | 36 | assay format | Scientific Literature | ||
6. | ALA5154509 | B | Selectivity index, ratio of IC50 for inhibition of recombinant human TYK2 to IC50 for inhibition of recombinant human JAK1 | Homo sapiens | 38 | assay format | Scientific Literature |