| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA5154504 | B | Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method | Homo sapiens | 38 | single protein format | Scientific Literature | ||
| 2. | ALA5154505 | B | Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method | Homo sapiens | 38 | single protein format | Scientific Literature | ||
| 3. | ALA5154506 | B | Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method | Homo sapiens | 38 | single protein format | Scientific Literature | ||
| 4. | ALA5154507 | B | Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based scintillation counting method | Homo sapiens | 38 | single protein format | Scientific Literature | ||
| 5. | ALA5154508 | B | Selectivity index, ratio of IC50 for inhibition of recombinant human JAK2 to IC50 for inhibition of recombinant human JAK1 | Homo sapiens | 36 | assay format | Scientific Literature | ||
| 6. | ALA5154509 | B | Selectivity index, ratio of IC50 for inhibition of recombinant human TYK2 to IC50 for inhibition of recombinant human JAK1 | Homo sapiens | 38 | assay format | Scientific Literature | ||
| 7. | ALA5154510 | A | Apparent permeability across apical to basolateral side in human Caco-2 cells at 10 uM measured after 120 mins by LC-MS/MS analysis | Homo sapiens | 7 | cell-based format | Scientific Literature | ||
| 8. | ALA5154511 | A | Apparent permeability across basolateral to apical side in human Caco-2 cells at 10 uM measured after 120 mins by LC-MS/MS analysis | Homo sapiens | 7 | cell-based format | Scientific Literature | ||
| 9. | ALA5154512 | A | Efflux ratio of apparent permeability from basolateral to apical side over apical to basolateral side in human Caco-2 cells at 10 uM incubated for 120 mins by LC-MS/MS analysis | Homo sapiens | 7 | cell-based format | Scientific Literature | ||
| 10. | ALA5154513 | A | Plasma protein binding in human assessed as unbound fraction at 2 uM incubated for 4 hrs by LC/MS/MS based balanced dialysis method | Homo sapiens | 7 | cell-free format | Scientific Literature | ||
| 11. | ALA5154514 | A | Plasma protein binding in mouse assessed as unbound fraction at 2 uM incubated for 4 hrs by LC/MS/MS based balanced dialysis method | Mus musculus | 7 | cell-free format | Scientific Literature | ||
| 12. | ALA5154515 | A | Plasma protein binding in rat assessed as unbound fraction at 2 uM incubated for 4 hrs by LC/MS/MS based balanced dialysis method | Rattus norvegicus | 7 | cell-free format | Scientific Literature | ||
| 13. | ALA5154516 | A | Microsomal stability in mouse liver microsomes assessed as intrinsic clearance at 1 uM incubated for 60 mins in presence of NADPH regenerating system by LC-MS/MS analysis | Mus musculus | 7 | microsome format | Scientific Literature | ||
| 14. | ALA5154517 | A | Microsomal stability in rat liver microsomes assessed as intrinsic clearance at 1 uM incubated for 60 mins in presence of NADPH regenerating system by LC-MS/MS analysis | Rattus norvegicus | 7 | microsome format | Scientific Literature | ||
| 15. | ALA5154518 | A | Microsomal stability in human liver microsomes assessed as intrinsic clearance at 1 uM incubated for 60 mins in presence of NADPH regenerating system by LC-MS/MS analysis | Homo sapiens | 7 | microsome format | Scientific Literature | ||
| 16. | ALA5154519 | A | Metabolic stability in mouse hepatocytes assessed as intrinsic clearance at 1 uM incubated for 90 mins by LC/MS/MS analysis | Mus musculus | 7 | cell-based format | Scientific Literature | ||
| 17. | ALA5154520 | A | Metabolic stability in rat hepatocytes assessed as intrinsic clearance at 1 uM incubated for 90 mins by LC/MS/MS analysis | Rattus norvegicus | 7 | cell-based format | Scientific Literature | ||
| 18. | ALA5154521 | A | Metabolic stability in human hepatocytes assessed as intrinsic clearance at 1 uM incubated for 90 mins by LC/MS/MS analysis | Homo sapiens | 7 | cell-based format | Scientific Literature | ||
| 19. | ALA5154522 | A | Inhibition of CYP1A2 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis | Homo sapiens | 7 | microsome format | Scientific Literature | ||
| 20. | ALA5154523 | A | Inhibition of CYP2B6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysis | Homo sapiens | 7 | microsome format | Scientific Literature |
The page will load shortly, Thanks for your patience!