| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA840500 | ADME | Clearance in dog | Canis lupus familiaris | 2 | ALA1139577 | organism-based format | Scientific Literature | |
| 2. | ALA840501 | ADME | Clearance in rat | Rattus norvegicus | 2 | ALA1139577 | organism-based format | Scientific Literature | |
| 3. | ALA838969 | ADME | Half life in dog | Canis lupus familiaris | 2 | ALA1139577 | assay format | Scientific Literature | |
| 4. | ALA826150 | ADME | Half life in rat | Rattus norvegicus | 2 | ALA1139577 | assay format | Scientific Literature | |
| 5. | ALA828503 | Binding | Inhibitory concentration against MMP-1 | 23 | ALA1139577 | single protein format | Scientific Literature | ||
| 6. | ALA828505 | Binding | Inhibitory concentration against MMP-2 | 1 | ALA1139577 | single protein format | Scientific Literature | ||
| 7. | ALA828507 | Binding | Inhibitory concentration against MMP-3 | 1 | ALA1139577 | single protein format | Scientific Literature | ||
| 8. | ALA828509 | Binding | Inhibitory concentration against MMP-8 | 1 | ALA1139577 | single protein format | Scientific Literature | ||
| 9. | ALA828510 | Binding | Inhibitory concentration against MMP-9 | 1 | ALA1139577 | single protein format | Scientific Literature | ||
| 10. | ALA828527 | Binding | Inhibitory concentration against MMP-13 | 23 | ALA1139577 | assay format | Scientific Literature | ||
| 11. | ALA828528 | Binding | Inhibitory concentration against MMP-14 | 1 | ALA1139577 | single protein format | Scientific Literature | ||
| 12. | ALA827846 | Binding | Inhibitory concentration against aggrecanase from porcine chondrocytes using [35S]-sulfate (5 mCi/ml) as radioligand and adding IL-1alpha (5 ng/ml) incubated for 10h | Sus scrofa | 19 | ALA1139577 | assay format | Scientific Literature | |
| 13. | ALA832513 | Functional | Potent inhibition of IL-1 induced aggrecan degradation in hamster | Cricetulus griseus | 1 | ALA1139577 | organism-based format | Scientific Literature | |
| 14. | ALA833683 | Functional | Potent inhibition of MMP-13 induced collagen degradation in hamster knee joints | Cricetulus griseus | 1 | ALA1139577 | organism-based format | Scientific Literature | |
| 15. | ALA834285 | Functional | Inhibitory concentration against TNF-alpha release in LPS treated whole blood | Homo sapiens | 1 | ALA1139577 | tissue-based format | Scientific Literature | |
| 16. | ALA834681 | Functional | Inhibition of IL-1 induced aggrecan degradation in human osteoarthritic cartilage | Homo sapiens | 1 | ALA1139577 | cell-based format | Scientific Literature | |
| 17. | ALA834700 | Functional | Inhibition of IL-1 induced aggrecan degradation in bovine nasal cartilage explants | Bos taurus | 1 | ALA1139577 | organism-based format | Scientific Literature | |
| 18. | ALA833403 | Functional | Inhibition of IL-1 induced collagen degradation in bovine nasal cartilage explants | Bos taurus | 1 | ALA1139577 | organism-based format | Scientific Literature | |
| 19. | ALA3388950 | Binding | Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay | Homo sapiens | 9 | ALA3351955 | single protein format | Scientific Literature | |
| 20. | ALA3388951 | Binding | Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay | Homo sapiens | 9 | ALA3351955 | single protein format | Scientific Literature |
The page will load shortly, Thanks for your patience!