| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA946270 | B | Inhibition of human FIH | Homo sapiens | 1 | single protein format | Scientific Literature | ||
| 2. | ALA1068586 | B | Inhibition of human recombinant FIH1 | Homo sapiens | 9 | single protein format | Scientific Literature | ||
| 3. | ALA1243627 | B | Activity of FIH-1 | 3 | single protein format | Scientific Literature | |||
| 4. | ALA1798571 | B | Inhibition of asparaginyl hydroxylase factor-inhibiting-HIF | 2 | single protein format | Scientific Literature | |||
| 5. | ALA1804280 | B | Inhibition of FIH assessed as inhibition of hydroxylation of C-TAD peptide at 100 uM after 2 hrs by fluorescent polarization assay in presence of 2-oxoglutarate | 3 | single protein format | Scientific Literature | |||
| 6. | ALA1942540 | B | Inhibition of FIH | 2 | single protein format | Scientific Literature | |||
| 7. | ALA2167515 | B | Inhibition of human FIH expressed in Escherichia coli by MALDI assay | Homo sapiens | 10 | assay format | Scientific Literature | ||
| 8. | ALA3112250 | B | Inhibition of FIH (unknown origin) by mass spectrometry | Homo sapiens | 2 | single protein format | Scientific Literature | ||
| 9. | ALA3776331 | B | Inhibition of N-terminal His6-tagged full-length FIH (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using SMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay | Homo sapiens | 6 | assay format | Scientific Literature | ||
| 10. | ALA4340710 | B | Inhibition of recombinant human FIH using 2OG as substrate and Fe2 as co-factor assessed as hydroxylation incubated for 15 mins in presence of L-ascorbate by LC-MS analysis | Homo sapiens | 5 | single protein format | Scientific Literature | ||
| 11. | ALA4396996 | B | Inhibition of FIH (unknown origin) | Homo sapiens | 1 | single protein format | Scientific Literature | ||
| 12. | ALA5032402 | B | Inhibition of human FIH using HLEVVKLLLEAGADVNAQDK-CONH2 as substrate preincubated for 15 mins followed by substrate addition and measured after 15 mins by RapidFire Mass spectrometry assay | Homo sapiens | 13 | single protein format | Scientific Literature | ||
| 13. | ALA5215682 | B | Inhibition of FIH (unknown origin) assessed as hydroxylation of HIF1alphaCAD by MALDI-TOF-MS analysis | Homo sapiens | 3 | single protein format | Scientific Literature | ||
| 14. | ALA5215684 | B | Inhibition of FIH (unknown origin) by solid-phase extraction coupled to MS based assay | Homo sapiens | 3 | single protein format | Scientific Literature | ||
| 15. | ALA5216105 | B | Inhibition of human FIH preincubated for 15 mins followed by substrate addition and measured after 15 mins using ankyrin peptide HLEVVKLLLEAGADVNAQDK-CONH2 as substrate by SPE-MS-based assay | Homo sapiens | 8 | single protein format | Scientific Literature | ||
| 16. | ALA5229125 | B | Inhibition of human FIH expressed in H5 insect cells | Homo sapiens | 5 | cell-based format | Scientific Literature | ||
| 17. | ALA5229129 | B | Inhibition of N-terminal His-tagged human FIH expressed in Escherichia coli | Homo sapiens | 2 | assay format | Scientific Literature | ||
| 18. | ALA5229132 | B | Inhibition of FIH (unknown origin) | Homo sapiens | 1 | single protein format | Scientific Literature |
The page will load shortly, Thanks for your patience!