| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA2349830 | B | Inhibition of CDK9/cyclin K (unknown origin) using [gamma-33P]ATP assessed as residual activity at 3 uM | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 2. | ALA2380165 | B | Inhibition of human CDK9/Cyclin K at 0.1 uM incubated for 15 mins prior to substrate addition measured after 90 mins by P33-radiolabeled assay relative to control | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 3. | ALA2380176 | B | Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured after 90 mins by P33-radiolabeled assay | Homo sapiens | 2 | protein complex format | Scientific Literature | ||
| 4. | ALA2405326 | B | Inhibition of CDK9/cyclin K (unknown origin) at 10 uM relative to control | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 5. | ALA3632308 | B | Inhibition of CDK9/cyclin K (unknown origin) at 10 uM after 120 mins P33 radiolabeled kinase activity assay | Homo sapiens | 3 | protein complex format | Scientific Literature | ||
| 6. | ALA3748668 | B | Inhibition of human CDK9/cyclin K using [KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC] as substrate | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 7. | ALA3762301 | B | Inhibition of CDK9/cyclinK (unknown origin) at 100 nM | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 8. | ALA3801087 | B | Inhibition of full length human recombinant N-terminal GST-tagged CDK9/Cyclin K expressed in baculovirus infected sf9 cells using CDKtide as substrate at 100 uM incubated for 10 mins by scintillation counting method relative to control | Homo sapiens | 4 | cell-based format | Scientific Literature | ||
| 9. | ALA3801104 | B | Inhibition of CDK9/Cyclin K (unknown origin) | Homo sapiens | 2 | protein complex format | Scientific Literature | ||
| 10. | ALA3817242 | B | Inhibition of human CDK9/cyclin K at 1 uM using [KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC] as substrate | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 11. | ALA3856495 | B | Inhibition of human CDK9/cyclin K by radiometric assay relative to control | Homo sapiens | 6 | protein complex format | Scientific Literature | ||
| 12. | ALA3999021 | B | Inhibition of full-length recombinant human N-terminal GST-tagged CDK9/cyclin K expressed in baculovirus infected sf9 cells assessed as residual activity at 100 uM using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by ADP-Glo bioluminescence assay relative to control relative to control | Homo sapiens | 1 | cell-based format | Scientific Literature | ||
| 13. | ALA4048329 | B | Inhibition of CDK9/cyclin K (unknown origin) after 30 mins in presence of [33P]-gamma-ATP by filter binding assay | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 14. | ALA4059196 | B | Inhibition of human CDK9/Cyclin K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filter binding method | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 15. | ALA4264037 | B | Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature for 5 mins by ADP-Glo reagent based luminescence assay | Homo sapiens | 33 | protein complex format | Scientific Literature | ||
| 16. | ALA4327634 | B | Inhibition of human CDK9/cyclin-K assessed as residual activity at 1 uM using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assay relative to control | Homo sapiens | 2 | protein complex format | Scientific Literature | ||
| 17. | ALA4327995 | B | Inhibition of human CDK9/cyclin-K assessed as residual activity at 100 uM using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 18. | ALA4328359 | B | Inhibition of human CDK9/cyclin-K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assay | Homo sapiens | 1 | protein complex format | Scientific Literature | ||
| 19. | ALA4346780 | B | Inhibition of human recombinant full length His-tagged CDK9/cyclin K expressed in baculovirus expression system | Homo sapiens | 1 | assay format | Scientific Literature | ||
| 20. | ALA4352317 | B | Inhibition of human CDK9/cyclin-K at 10 uM using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate in presence of [gamma-33P]-ATP | Homo sapiens | 1 | protein complex format | Scientific Literature |
The page will load shortly, Thanks for your patience!