| # | Aladdin ID | Assay Type | Description | Organism | Compounds | Reference | BAO Format | Source | |
|---|---|---|---|---|---|---|---|---|---|
| 1. | ALA4327636 | B | Inhibition of human CDK9/cyclin-T2 assessed as residual activity at 1 uM using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assay relative to control | Homo sapiens | 2 | ALA4325871 | protein complex format | Scientific Literature | |
| 2. | ALA4327997 | B | Inhibition of human CDK9/cyclin-T2 assessed as residual activity at 100 uM using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assay relative to control | Homo sapiens | 1 | ALA4325871 | protein complex format | Scientific Literature | |
| 3. | ALA4328361 | B | Inhibition of human CDK9/cyclin-T2 using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assay | Homo sapiens | 1 | ALA4325871 | protein complex format | Scientific Literature | |
| 4. | ALA4366344 | B | Inhibition of human CDK9/cyclin-T2 at 100 nM using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assay | Homo sapiens | 1 | ALA4364276 | protein complex format | Scientific Literature | |
| 5. | ALA5058130 | B | Inhibition of CDK9/cyclin-T2 (unknown origin) at 1 uM | Homo sapiens | 1 | ALA5055685 | protein complex format | Scientific Literature | |
| 6. | ALA5123405 | B | Inhibition of CDK9/Cyclin T2 (unknown origin) | Homo sapiens | 1 | ALA5120846 | protein complex format | Scientific Literature |
The page will load shortly, Thanks for your patience!