Echistatin,α1 isoform，TFA salt, CAS No.154303-05-6(free base)

Item Number

E286592

• Product Name: Echistatin,α1 isoform，TFA salt, CAS No.154303-05-6(free base)
• Specifications & Purity: 95%
• Amino Acids: Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr
• Sequence: ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT(Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)

Product Description

Potent irreversible αVβ3 Integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced Platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro. 

Application：

Echistatin has been used:as an inhibitor of integrin function to study the role of microfibril-associated glycoprotein-1 (Magp1) in the morphogenesis of vascular structures for the preparation of microbubbles targeted to αvβ3 integrins in tumor angiogenesis imaging as a conjugate to αvβ3 in flow cytometric binding studies