Lixisenatide acetate - 98%, high purity , CAS No.1997361-87-1

Item Number

L275704

• Synonyms: AVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu
• Specifications & Purity: ≥98%
• Biochemical and Physiological Mechanisms: Lixisenatide is a short acting, potent and selective short peptide-based GLP-1 receptor agonist. The in vivo half-life is\xa0 2-4 hours. Displays an IC 50 of 1.4 nM at the human GLP-1 receptor in in vitro binding assays.
• Storage Temp: Store at -20°C,Argon charged
• Shipped In: Ice chest + Ice pads

Product Description

Shipped at 4°C. Store at -20°C.