Lixisenatide acetate - 98%, high purity , CAS No.1997361-87-1

  • ≥98%
Item Number
L275704
Grouped product items
SKUSizeAvailabilityPrice Qty
L275704-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$92.90
L275704-5mg
5mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$187.90
L275704-10mg
10mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$305.90
L275704-25mg
25mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$512.90
L275704-50mg
50mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$733.90
L275704-100mg
100mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$997.90

Short acting, potent and selective peptidic GLP-1 receptor agonist

View related series
Glucagon receptor

Basic Description

SynonymsAVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu
Specifications & Purity98%
Storage TempStore at -20°C,Argon charged
Shipped InIce chest + Ice pads
Product Description

Shipped at 4°C. Store at -20°C.

Names and Identifiers

Alternate CAS CAS 320367-13-3 (free base)
Molecular Weight 4858.49(free base)

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

12 results found

Lot NumberCertificate TypeDateItem
F2414159Certificate of AnalysisFeb 26, 2024 L275704
F2414175Certificate of AnalysisFeb 26, 2024 L275704
F2414189Certificate of AnalysisFeb 26, 2024 L275704
F2414197Certificate of AnalysisFeb 26, 2024 L275704
F2414198Certificate of AnalysisFeb 26, 2024 L275704
F2414199Certificate of AnalysisFeb 26, 2024 L275704
F2414200Certificate of AnalysisFeb 26, 2024 L275704
F2414212Certificate of AnalysisFeb 26, 2024 L275704
F2414213Certificate of AnalysisFeb 26, 2024 L275704
F2414219Certificate of AnalysisFeb 26, 2024 L275704
F2414220Certificate of AnalysisFeb 26, 2024 L275704
F2414221Certificate of AnalysisFeb 26, 2024 L275704

Show more⌵

Chemical and Physical Properties

Solubilitysoluble in water to 100 mg/mL .
SensitivityMoisture sensitive

Related Documents

Solution Calculators