| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| np140227-10mg | 10mg | In stock | $19.90 | |
| np140227-100mg | 100mg | In stock | $79.90 | |
| np140227-1g | 1g | In stock | $399.90 |
≥95% (HPLC&SDS-PAGE)
| Product Name | Native Rabbit Serum Albumin Protein |
|---|---|
| Synonyms | ALB; ALBU; Albumin; cell growth inhibiting protein 42; DKFZp779N1935; growth-inhibiting protein 20; PRO0883; PRO0903; PRO1341; serum albumin |
| Grade | Azide Free, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | Carrier Free, Azide Free, ≥95%(SDS-PAGE&HPLC) |
| Species | Rabbit |
| Amino Acids | 25-608 aa |
| Sequence | EAHKSEIAHRFNDVGEEHFIGLVLITFSQYLQKCPYEEHAKLVKEVTDLAKACVADESAANCDKSLHDIFGDKICALPSLRDTYGDVADCCEKKEPERNECFLHHKDDKPDLPPFARPEADVLCKAFHDDEKAFFGHYLYEVARRHPYFYAPELLYYAQKYKAILTECCEAADKGACLTPKLDALEGKSLISAAQERLRCASIQKFGDRAYKAWALVRLSQRFPKADFTDISKIVTDLTKVHKECCHGDLLECAD |
| Conjugation | Unconjugated |
| Accession # | P49065 |
| Predicted molecular weight | 66 kDa |
| SDS-PAGE | 57.2 kDa, under reducing conditions; 62.4 kDa, under non-reducing conditions. |
Native Rabbit Serum Albumin Protein (np140227) - SDS-PAGE
3 μg/lane of Native Rabbit Serum Albumin Protein (np140227) was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 57.2 kDa under reducing conditions and 62.4 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in pure water or normal saline or PBS to a concentration of 1%-10% according to requirement. |
| Storage Temp | Store at 2-8°C |
| Shipped In | Wet ice |
| Stability And Storage | Store at 2-8 ℃. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101716 | Certificate of Analysis | Nov 20, 2023 | np140227 |
| ZJ23F1101715 | Certificate of Analysis | Nov 20, 2023 | np140227 |
| ZJ23F1101714 | Certificate of Analysis | Nov 20, 2023 | np140227 |
