| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp186498-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp186498-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $269.90 | |
| rp186498-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $429.90 | |
| rp186498-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free, ≥90% (SDS-PAGE), E. coli, C-His, 1-502 aa
| Product Name | Recombinant E. coli Glycerol kinase Protein |
|---|---|
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥90%(SDS-PAGE), Lot by Lot |
| Biochemical and Physiological Mechanisms | Glycerol kinase from E. coli (glpK) catalyzes the ATP-dependent phosphorylation of glycerol to produce sn-glycerol-3-phosphate (G3P), the first and rate-limiting step in the utilization of glycerol. In the presence of glycerol, glpK is stimulated by inter |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 1-502 aa |
| Sequence | MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPISGIAGDQQAALFGQL |
| Protein Tag | C-His |
| Predicted molecular weight | 57.0 kDa |
| SDS-PAGE | 52.3 kDa, under reducing conditions; 52.3 kDa, under non-reducing conditions. |
Recombinant E. coli Glycerol kinase Protein (rp186498) - SDS-PAGE
3 μg/lane of Recombinant E. coli Glycerol kinase Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 52.3 kDa.
| Concentration | Lot by Lot |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
