| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp176254-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp176254-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $499.90 | |
| rp176254-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $699.90 | |
| rp176254-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,999.90 |
Animal Free, >95% (SDS-PAGE), 293F cell, C-His tag, 1-188 aa
| Product Name | Recombinant Feline CD8 alpha Protein, >95% (SDS-PAGE), high purity |
|---|---|
| Grade | Animal Free, Azide Free, Carrier Free |
| Product Description | Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells. |
| Specifications & Purity | Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | >95% (SDS-PAGE) |
| Bioactivity | Bioassay data are not available. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-188 aa |
| Sequence | MASPVTAQLLPLALLLHAAAAAGPSPFRLSPVRVEGRLGQRVELQCEVLLSSAAPGCTWLFQKNEPAARPIFLAYLSRSRTKLAEELDPKQISGQRIQDTLYSLTLHRFRKEEEGYYFCSVVSNSVLYFSAFVPVFLPVKPTTTPAPRPPTQAPITTSQRVSLRPGTCQPSAGSTVEASGLDLSCDIYHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 19.2 kDa |
| SDS-PAGE | 26.2-38.3 kDa, under reducing conditions; 23.1-36.7 kDa, under non-reducing conditions |
Recombinant Feline CD8 alpha Protein (rp176254) - SDS-PAGE
3 μg/lane of Recombinant Feline CD8 alpha Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.2-38.3 kDa under reducing conditions and 23.1-36.7 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
