| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp169691-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp169691-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $239.90 | |
| rp169691-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $359.90 | |
| rp169691-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free,≥95% (SDS-PAGE), Active, E. coli, N-His tag, 71-254 aa
| Product Name | Recombinant Human 4-1BB Ligand/TNFSF9 Protein |
|---|---|
| Grade | Bioactive, Carrier Free |
| Product Description | Purity:≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
| Specifications & Purity | Carrier Free, Bioactive, ≥95%(SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human 4-1BB/TNFRSF9 Protein (rp169624) at 2.0 μg/mL can bind Recombinant Human 4-1BB Ligand/TNFSF9 Protein (rp169691) with the EC50 of 6.053 ng/mL. |
| Endotoxin Concentration | <1 EU/μg |
| Expression System | E. coli |
| Amino Acids | 71-254 aa |
| Sequence | MGMKHHHHHHENLYFQGSREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Protein Tag | N-His |
| Predicted molecular weight | 21.7 kDa |
| SDS-PAGE | 20.6 kDa, under reducing conditions; 20.6 kDa, under non-reducing conditions |
Recombinant Human 4-1BB Ligand/TNFSF9 Protein (rp169691) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BB Ligand/TNFSF9 Protein (rp169691) at 2.0 μg/mL can bind Human 4-1BB Ligand/TNFSF9-biotin with the EC₅₀ of 6.053 ng/mL.
Recombinant Human 4-1BB Ligand/TNFSF9 Protein (rp169691) - SDS-PAGE
2 μg/lane of Recombinant Human 4-1BB Ligand/TNFSF9 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 20.6 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24R0500527 | Certificate of Analysis | May 10, 2024 | rp169691 |
