| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp142573-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $161.90 | |
| rp142573-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $477.90 | |
| rp142573-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $761.90 | |
| rp142573-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $5,321.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F, His tag, 19-244 aa
| Product Name | Recombinant Human Adiponectin/Acrp30 Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | ACDC; Acrp30; ACRP30; ADPN; adipocyte, C1Q and collagen domain containing; Adiponectin; adiponectin, C1Q and collagen domain containing; AdipoQ; ADIPQTL1; ApM1; apM-1; APM1; APM-1; C1q and collagen domain-containing protein; GBP28; GBP28apM1; Gelatin-bind |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Species | Human |
| Amino Acids | 19 to 244 |
| Sequence | ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNHHHHHH |
| Protein Tag | 6×His tag C-terminus |
| N-terminal Sequence | Glu |
| Accession # | Q15848 |
| Predicted molecular weight | 25 kDa |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
Recombinant Human Adiponectin/Acrp30 Protein (rp142573) - Protein Bioactivity
Fully biologically active determined by the dose dependent increase in MCF7 cell proliferation. The ED₅₀ for this effect is 0.18 μg/mL. Adiponectin induces a dichotomic effect on breast cancer growth. It stimulates growth in ERα+ MCF-7 cells while inhibiting proliferation of ERα- MDA-MB-231 cells.
Recombinant Human Adiponectin/Acrp30 Protein (rp142573) - Protein Bioactivity
Measured by its ability to induce TIMP-1 secretion by mouse macrophages. The ED₅₀ for this effect is 2.14 µg/mL.
Recombinant Human Adiponectin/Acrp30 Protein (rp142573) - SDS-PAGE
3 μg/lane of Recombinant Human Adiponectin/Acrp30 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 31.2 kDa under reducing conditions and 30.2 & 55.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-1.0 mg/ml. |
| Storage Temp | Store at -20°C |
| Shipped In | Dry ice |
| Stability And Storage | Store at -20~-80℃ for more than 1 year |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101660 | Certificate of Analysis | Nov 20, 2023 | rp142573 |
| ZJ23F1101658 | Certificate of Analysis | Nov 20, 2023 | rp142573 |
| ZJ23F1101657 | Certificate of Analysis | Nov 20, 2023 | rp142573 |
| 1. Maeda K, Okubo K, Shimomura I, Funahashi T, Matsuzawa Y, Matsubara K. (1996) cDNA cloning and expression of a novel adipose specific collagen-like factor, apM1 (AdiPose Most abundant Gene transcript 1).. Biochem Biophys Res Commun, 221 (2): (286-9). [PMID:8619847] |
| 2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al.. (2004) The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res, 14 (10B): (2121-7). [PMID:15489334] |
| 3. Nakano, Y Y, Tobe, T T, Choi-Miura, N H NH, Mazda, T T and Tomita, M M.. (1996) Isolation and characterization of GBP28, a novel gelatin-binding protein purified from human plasma.. Journal of biochemistry, [PMID:8947845] |
| 4. Saito, K K and 8 more authors.. (1999) Organization of the gene for gelatin-binding protein (GBP28).. Gene, (18): [PMID:10095105] |
| 5. Schäffler, A A and 7 more authors.. (1999) The human apM-1, an adipocyte-specific gene linked to the family of TNF's and to genes expressed in activated T cells, is mapped to chromosome 1q21.3-q23, a susceptibility locus identified for familial combined hyperlipidaemia (FCH).. Biochemical and biophysical research communications, (5): [PMID:10403784] |
| 6. Takahashi, M M and 13 more authors.. (2000) Genomic structure and mutations in adipose-specific gene, adiponectin.. International journal of obesity and related metabolic disorders : journal of the International Association for the Study of Obesity, [PMID:10918532] |
| 7. Yokota, T T and 10 more authors.. (2000) Adiponectin, a new member of the family of soluble defense collagens, negatively regulates the growth of myelomonocytic progenitors and the functions of macrophages.. Blood, (1): [PMID:10961870] |
| 8. Ouchi, N N and 14 more authors.. (2000) Adiponectin, an adipocyte-derived plasma protein, inhibits endothelial NF-kappaB signaling through a cAMP-dependent pathway.. Circulation, (12): [PMID:10982546] |
| 9. Yamauchi, T T and 24 more authors.. (2001) The fat-derived hormone adiponectin reverses insulin resistance associated with both lipoatrophy and obesity.. Nature medicine, [PMID:11479627] |
| 10. Hara, Kazuo K and 23 more authors.. (2002) Genetic variation in the gene encoding adiponectin is associated with an increased risk of type 2 diabetes in the Japanese population.. Diabetes, [PMID:11812766] |
| 11. Kondo, Hidehiko H and 11 more authors.. (2002) Association of adiponectin mutation with type 2 diabetes: a candidate gene for the insulin resistance syndrome.. Diabetes, [PMID:12086969] |
| 12. Vasseur, Francis F and 14 more authors.. (2002) Single-nucleotide polymorphism haplotypes in the both proximal promoter and exon 3 of the APM1 gene modulate adipocyte-secreted adiponectin hormone levels and contribute to the genetic risk for type 2 diabetes in French Caucasians.. Human molecular genetics, (1): [PMID:12354786] |
| 13. Waki, Hironori H and 12 more authors.. (2003) Impaired multimerization of human adiponectin mutants associated with diabetes. Molecular structure and multimer formation of adiponectin.. The Journal of biological chemistry, (10): [PMID:12878598] |
| 14. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 15. Richards, Ayanthi A AA and 6 more authors.. (2006) Adiponectin multimerization is dependent on conserved lysines in the collagenous domain: evidence for regulation of multimerization by alterations in posttranslational modifications.. Molecular endocrinology (Baltimore, Md.), [PMID:16497731] |
| 16. Richards, Ayanthi A AA and 13 more authors.. (2010) Sialic acid modification of adiponectin is not required for multimerization or secretion but determines half-life in circulation.. Molecular endocrinology (Baltimore, Md.), [PMID:19855092] |
| 17. Min, Xiaoshan X and 7 more authors.. (2012) Crystal structure of a single-chain trimer of human adiponectin globular domain.. FEBS letters, (23): [PMID:22449980] |
| 18. Rosenow, Anja A and 6 more authors.. (2012) Resveratrol-induced changes of the human adipocyte secretion profile.. Journal of proteome research, (7): [PMID:22905912] |
