| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp179839-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp179839-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $269.90 | |
| rp179839-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $429.90 | |
| rp179839-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,399.90 |
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, N-His tag, 2-323 aa
| Product Name | Recombinant Human Aldo-keto Reductase 1C3/AKR1C3 Protein |
|---|---|
| Grade | ActiBioPure™, Bioactive, Carrier Free |
| Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, ≥95%(SDS-PAGE), Lot by Lot |
| Biochemical and Physiological Mechanisms | AKR1C3 is a member of the aldo-keto reductase (AKR) superfamily. It catalyzes oxidation/reduction reactions at the 3-alpha, 20-alpha, and 17-beta positions of steroids. It is also known as Prostaglandin F synthase as it reduces prostaglandin D2 to F2, and |
| Bioactivity | Immobilized Recombinant Human Aldo-keto Reductase 1C3/AKR1C3 Protein (rp179839) at 1.0 μg/mL can bind Recombinant AKR1C3 Antibody (Ab087886) with the EC50 of 10.5 ng/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Amino Acids | 2-323 aa |
| Sequence | MHHHHHHDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHK |
| Predicted molecular weight | 37.7 kDa |
| SDS-PAGE | 36.4 kDa, under reducing conditions; 36.7 kDa, under non-reducing conditions. |
Recombinant Human Aldo-keto Reductase 1C3/AKR1C3 Protein (rp179839) - ELISA
Immobilized Recombinant Human Aldo-keto Reductase 1C3/AKR1C3 Protein (rp179839) at 1.0 μg/mL can bind Recombinant AKR1C3 Antibody (Ab087886) with the EC₅₀ of 10.5 ng/mL.
Recombinant Human Aldo-keto Reductase 1C3/AKR1C3 Protein (rp179839) - SDS-PAGE
3 μg/lane of Recombinant Human Aldo-keto Reductase 1C3/AKR1C3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 36.4 kDa under reducing conditions and 36.7 kDa under non-reducing conditions.
| Concentration | Lot by Lot |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
