Skip to the beginning of the images gallery

Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein, ≥95% (SDS-PAGE), high purity

ActiBioPure™
Animal Free
Azide Free
Bioactive
Carrier Free
≥95%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Accession #: O43827
Protein Tag: C-His
Bioactivity: When Recombinant Human LILRB1/CD85j/ILT2 Protein (rp148284) is coated at 4.0 µg/mL, Biotinylated Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein (rp142833) binds with the ED₅₀ of 2.0 μg/mL.
Endotoxin Concentration: ＜0.1 EU/μg

Item Number

rp142833

Grouped product items
SKU	Size	Availability	Price
rp142833-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp142833-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$599.90
rp142833-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$959.90
rp142833-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,949.90

Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 27-346 aa

View related series

Accession#:O43827 Angiopoietin-like 7 ANGPTL7 Gene ID:10218

Basic Description

Product Name	Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein, ≥95% (SDS-PAGE), high purity
Synonyms	Angiopoietin like 7; Angiopoietin like factor; Angiopoietin like factor (CDT6); Angiopoietin related protein 7; Angiopoietin-like factor; Angiopoietin-like protein 7; Angiopoietin-related protein 7; ANGL7_HUMAN; ANGPTL7; AngX; CDT6; Cornea derived transcr
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥95% (SDS-PAGE) Endotoxin level ＜0.1 EU/μg Function Angiopoietin-like 7 (ANGPTL7), also known as Corneal-Derived Transcript 6 (CDT6), is a secreted glycoprotein that is structurally related to the angiopoietins. Members of this protein family contain an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain . ANGPTL7 shares 89% aa sequence identity with mouse and rat ANGPTL7. It is secreted as a 45 ‑ 50 kDa monomer that forms disulfide-linked homotrimers and tetramers via the coiled coil domain . ANGPTL7 is expressed in the corneal stroma, trabecular meshwork, and sclera and is elevated in glaucoma aqueous humor . Its production is up‑regulated in trabecular meshwork cells by glucocorticoids and TGF-beta and in cartilage by TNF-alpha. Overexpression of ANGPTL7 in trabecular meshwork cells inhibits the production of collagen and proteoglycans . When overexpressed in tumor cells it promotes collagen and proteoglycan deposition but inhibits tumor xenograft progression and tumor angiogenesis . Recently, ANGPTL proteins, including ANGPTL-2, -3, -4, -5 and -7, are identified as growth factors in combination with SCF, Thrombopoietin, IGF-II and FGF acidic that enhance the expansion and engraftment of human and mouse hematopoietic stem cells."
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	≥95% (SDS-PAGE)
Bioactivity	When Recombinant Human LILRB1/CD85j/ILT2 Protein (rp148284) is coated at 4.0 µg/mL, Biotinylated Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein (rp142833) binds with the ED₅₀ of 2.0 μg/mL.
Endotoxin Concentration	＜0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	27-346 aa
Sequence	QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNC
Protein Tag	C-His
Accession #	O43827
Predicted molecular weight	36 kDa
SDS-PAGE	34 - 35 kDa & 45 - 50 kDa , under reducing condition.

Images

Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein (rp142833) - Protein Bioactivity
When Recombinant Human LILRB1/CD85j/ILT2 Protein (rp148284) is coated at 4.0 µg/mL, Biotinylated Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein (rp142833) binds with the ED ₅₀ of 2.0 μg/mL.

Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein (rp142833) - SDS-PAGE
3 μg/lane of Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein was resolved with SDS-PAGE under reducing (R) condition and visualized by Coomassie® Blue staining, showing the band at 34 - 35 kDa & 45 - 50 kDa under reducing condition.

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0606785	Certificate of Analysis	Jun 14, 2024	rp142833
ZJ24F0606784	Certificate of Analysis	Jun 14, 2024	rp142833
ZJ24F0606783	Certificate of Analysis	Jun 14, 2024	rp142833

References

1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309]
2. Peek R, van Gelderen BE, Bruinenberg M, Kijlstra A. (1998) Molecular cloning of a new angiopoietinlike factor from the human cornea.. Invest Ophthalmol Vis Sci, 39 (10): (1782-8). [PMID:9727400]
3. Stover, C C and 12 more authors.. (2001) The human gene for mannan-binding lectin-associated serine protease-2 (MASP-2), the effector component of the lectin route of complement activation, is part of a tightly linked gene cluster on chromosome 1p36.2-3.. Genes and immunity, [PMID:11426320]
4. Peek, Ron R, Kammerer, Richard A RA, Frank, Sabine S, Otte-Höller, Irene I and Westphal, Johan R JR.. (2002) The angiopoietin-like factor cornea-derived transcript 6 is a putative morphogen for human cornea.. The Journal of biological chemistry, (4): [PMID:11682471]
5. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161]
6. Rozsa, Frank W FW and 10 more authors.. (2006) Gene expression profile of human trabecular meshwork cells in response to long-term dexamethasone exposure.. Molecular vision, (27): [PMID:16541013]
7. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414]
8. Comes, Núria N, Buie, Lakisha K LK and Borrás, Teresa T.. (2011) Evidence for a role of angiopoietin-like 7 (ANGPTL7) in extracellular matrix formation of the human trabecular meshwork: implications for glaucoma.. Genes to cells : devoted to molecular & cellular mechanisms, [PMID:21199193]
9. Oshikawa, Mio M and 8 more authors.. (2011) Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.. Investigative ophthalmology & visual science, (22): [PMID:21697133]
10. Toyono, Tetsuya T and 7 more authors.. (2015) Angiopoietin-like 7 is an anti-angiogenic protein required to prevent vascularization of the cornea.. PloS one, [PMID:25622036]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.