| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp169553-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | In stock | $59.90 | |
| rp169553-50μg | 50μg | In stock | $139.90 | |
| rp169553-100μg | 100μg | In stock | $199.90 | |
| rp169553-1mg | 1mg | In stock | $1,399.90 |
Carrier free, >95% SDS-PAGE, E.coli, N-His Tag, 21-119 aa
| Product Name | Recombinant Human β2-microglobulin Protein |
|---|---|
| Synonyms | Beta-2-Microglobulin; Beta Chain Of MHC Class I Molecules; IMD43; B2MB2MG_HUMAN; Beta 2 microglobulin; Beta 2 microglobulin precursor; Beta chain of mhc class 1 proteins; Beta chain of MHC class I molecules; Beta-2-microglobulin form pI 5.3; CDABP0092; Hd |
| Grade | Azide Free, Carrier Free |
| Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： B2M (Beta-2-Microglobulin) is a Protein Coding gene. Diseases associated with B2M include Immunodeficiency 43 and Amyloidosis, Familial Visceral. Among its related pathways are SARS-CoV-2 Infection and Infectious disease. Gene Ontology (GO) annotations related to this gene include identical protein binding. An important paralog of this gene is HLA-DPA1. |
| Specifications & Purity | Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Endotoxin Concentration | ＜1 EU/μg |
| Expression System | E. coli |
| Amino Acids | 21-119 aa |
| Sequence | MGSSHHHHHHSSGLVPRGSHMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
| Protein Tag | N-His |
| Predicted molecular weight | 14.0 kDa |
| SDS-PAGE | 14.0 kDa, reducing conditions; 14.0 kDa, non-reducing conditions |
Recombinant Human Beta-2 Microglobulin Protein (rp169553) - SDS-PAGE
3 μg/lane of Recombinant Human Beta-2 Microglobulin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 14 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1201878 | Certificate of Analysis | Dec 13, 2023 | rp169553 |
| ZJ23F1201877 | Certificate of Analysis | Dec 13, 2023 | rp169553 |
| ZJ23F1201876 | Certificate of Analysis | Dec 13, 2023 | rp169553 |
| ZJ23F1201875 | Certificate of Analysis | Dec 13, 2023 | rp169553 |
| ZJ23R1100162 | Certificate of Analysis | Nov 24, 2023 | rp169553 |
| 1. Argilés, A A, Derancourt, J J, Jauregui-Adell, J J, Mion, C C and Demaille, J G JG.. (1992) Biochemical characterization of serum and urinary beta 2 microglobulin in end-stage renal disease patients.. Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association, [PMID:1336137] |
| 2. Okon, M M, Bray, P P and Vucelić, D D.. (1992) 1H NMR assignments and secondary structure of human beta 2-microglobulin in solution.. Biochemistry, (22): [PMID:1390678] |
| 3. Saper, M A MA, Bjorkman, P J PJ and Wiley, D C DC.. (1991) Refined structure of the human histocompatibility antigen HLA-A2 at 2.6 A resolution.. Journal of molecular biology, (20): [PMID:2038058] |
| 4. Bjorkman, P J PJ and 5 more authors.. (1987) Structure of the human class I histocompatibility antigen, HLA-A2.. Nature, [PMID:3309677] |
| 5. Güssow, D D and 6 more authors.. (1987) The human beta 2-microglobulin gene. Primary structure and definition of the transcriptional unit.. Journal of immunology (Baltimore, Md. : 1950), (1): [PMID:3312414] |
| 6. Gorevic, P D PD and 8 more authors.. (1986) Polymerization of intact beta 2-microglobulin in tissue causes amyloidosis in patients on chronic hemodialysis.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:3532124] |
| 7. Cunningham, B A BA, Wang, J L JL, Berggård, I I and Peterson, P A PA.. (1973) The complete amino acid sequence of beta 2-microglobulin.. Biochemistry, (20): [PMID:4586824] |
| 8. Suggs, S V SV, Wallace, R B RB, Hirose, T T, Kawashima, E H EH and Itakura, K K.. (1981) Use of synthetic oligonucleotides as hybridization probes: isolation of cloned cDNA sequences for human beta 2-microglobulin.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:6171820] |
| 9. Momoi, T T and 5 more authors.. (1995) Amino acid sequence of a modified beta 2-microglobulin in renal failure patient urine and long-term dialysis patient blood.. Clinica chimica acta; international journal of clinical chemistry, (15): [PMID:7554280] |
| 10. Collins, E J EJ, Garboczi, D N DN, Karpusas, M N MN and Wiley, D C DC.. (1995) The three-dimensional structure of a class I major histocompatibility complex molecule missing the alpha 3 domain of the heavy chain.. Proceedings of the National Academy of Sciences of the United States of America, (14): [PMID:7862664] |
| 11. Miyata, T T and 7 more authors.. (1994) Glycation of human beta 2-microglobulin in patients with hemodialysis-associated amyloidosis: identification of the glycated sites.. Biochemistry, (11): [PMID:7918443] |
| 12. Haag-Weber, M M, Mai, B B and Hörl, W H WH.. (1994) Isolation of a granulocyte inhibitory protein from uraemic patients with homology of beta 2-microglobulin.. Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association, [PMID:8084451] |
| 13. Smith, K J KJ and 6 more authors.. (1996) Bound water structure and polymorphic amino acids act together to allow the binding of different peptides to MHC class I HLA-B53.. Immunity, [PMID:8624812] |
| 14. Braud, V M VM, Allan, D S DS, Wilson, D D and McMichael, A J AJ.. (1998) TAP- and tapasin-dependent HLA-E surface expression correlates with the binding of an MHC class I leader peptide.. Current biology : CB, (1): [PMID:9427624] |
| 15. Wainwright, S D SD, Biro, P A PA and Holmes, C H CH.. (2000) HLA-F is a predominantly empty, intracellular, TAP-associated MHC class Ib protein with a restricted expression pattern.. Journal of immunology (Baltimore, Md. : 1950), (1): [PMID:10605026] |
| 16. Rosa, F F and 5 more authors.. (1983) The beta2-microglobulin mRNA in human Daudi cells has a mutated initiation codon but is still inducible by interferon.. The EMBO journal, [PMID:11894933] |
| 17. Trinh, Chi H CH, Smith, David P DP, Kalverda, Arnout P AP, Phillips, Simon E V SE and Radford, Sheena E SE.. (2002) Crystal structure of monomeric human beta-2-microglobulin reveals clues to its amyloidogenic properties.. Proceedings of the National Academy of Sciences of the United States of America, (23): [PMID:12119416] |
| 18. Stewart-Jones, Guillaume B E GB, McMichael, Andrew J AJ, Bell, John I JI, Stuart, David I DI and Jones, E Yvonne EY.. (2003) A structural basis for immunodominant human T cell receptor recognition.. Nature immunology, [PMID:12796775] |
| 19. He, Xian-Hui XH, Xu, Li-Hui LH, Liu, Yi Y and Zeng, Yao-Ying YY.. (2004) [Cloning of human beta-microglobulin gene and its high expression in Escherichia coli].. Sheng wu gong cheng xue bao = Chinese journal of biotechnology, [PMID:16108498] |
| 20. Eakin, Catherine M CM, Berman, Andrea J AJ and Miranker, Andrew D AD.. (2006) A native to amyloidogenic transition regulated by a backbone trigger.. Nature structural & molecular biology, [PMID:16491088] |
| 21. Deng, Nan-Jie NJ, Yan, Lisa L, Singh, Deepak D and Cieplak, Piotr P.. (2006) Molecular basis for the Cu2+ binding-induced destabilization of beta2-microglobulin revealed by molecular dynamics simulation.. Biophysical journal, (1): [PMID:16513784] |
| 22. Wani, Manzoor A MA and 8 more authors.. (2006) Familial hypercatabolic hypoproteinemia caused by deficiency of the neonatal Fc receptor, FcRn, due to a mutant beta2-microglobulin gene.. Proceedings of the National Academy of Sciences of the United States of America, (28): [PMID:16549777] |
| 23. Kihara, Miho M and 7 more authors.. (2006) Conformation of amyloid fibrils of beta2-microglobulin probed by tryptophan mutagenesis.. The Journal of biological chemistry, (13): [PMID:16901902] |
| 24. Shiroishi, Mitsunori M and 8 more authors.. (2006) Structural basis for recognition of the nonclassical MHC molecule HLA-G by the leukocyte Ig-like receptor B2 (LILRB2/LIR2/ILT4/CD85d).. Proceedings of the National Academy of Sciences of the United States of America, (31): [PMID:17056715] |
| 25. Iwata, Kentaro K, Matsuura, Takanori T, Sakurai, Kazumasa K, Nakagawa, Atsushi A and Goto, Yuji Y.. (2007) High-resolution crystal structure of beta2-microglobulin formed at pH 7.0.. Journal of biochemistry, [PMID:17646174] |
| 26. Esposito, Gennaro G and 16 more authors.. (2008) The controlling roles of Trp60 and Trp95 in beta2-microglobulin function, folding and amyloid aggregation properties.. Journal of molecular biology, (9): [PMID:18395224] |
| 27. Ricagno, Stefano S and 7 more authors.. (2008) DE loop mutations affect beta2-microglobulin stability and amyloid aggregation.. Biochemical and biophysical research communications, (5): [PMID:18835253] |
| 28. Ricagno, Stefano S, Raimondi, Sara S, Giorgetti, Sofia S, Bellotti, Vittorio V and Bolognesi, Martino M.. (2009) Human beta-2 microglobulin W60V mutant structure: Implications for stability and amyloid aggregation.. Biochemical and biophysical research communications, (13): [PMID:19284997] |
| 29. Giorgetti, Sofia S and 17 more authors.. (2011) Effect of tetracyclines on the dynamics of formation and destructuration of beta2-microglobulin amyloid fibrils.. The Journal of biological chemistry, (21): [PMID:21068391] |
| 30. Valleix, Sophie S and 25 more authors.. (2012) Hereditary systemic amyloidosis due to Asp76Asn variant β2-microglobulin.. The New England journal of medicine, (14): [PMID:22693999] |
| 31. Sreejit, Gopalkrishna G and 6 more authors.. (2014) The ESAT-6 protein of Mycobacterium tuberculosis interacts with beta-2-microglobulin (β2M) affecting antigen presentation function of macrophage.. PLoS pathogens, [PMID:25356553] |
